Identifiers and Description

Gene Model Identifier

Contig1486.1.g68

Standard Name

bTEBP3

Aliases

Contig1486_1_g68

Description

Telomere-binding protein beta subunit (TEBP beta)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam07404 ) Telomere-binding protein beta subunit (TEBP beta)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1486.1.g68(coding)
ATGACAACCTCATATTTATTTGAGAACGAAAGACTCAAACCTATCATAGCTTCATATATA
AATTCCAATTTTGATTTTGAAGCCATTCCGTTGAACCTGCGCAAACATATGCGTTTAAGT
GTGCAAGAAAACATTGCAACTTTCTGGGTTAACGATGGTTTTCATTTCTTAGAAGCGCAG
TTTACTAAGGATGCTATTAATGAATTTCGCAAGTCCTATTCACATATTAAGTTCCAATCA
TTGAAAGGCGGTATTATGTTTATAAGTAAATGGAGCCTCAAGATTAAAGAATGTGACTCA
AGAAAAGTATATACCAGCTACTAAAATATGCAGATTCAGTTAGTCATTGAGAGTTTCAAG
CCCCTACTCCACGAGAAGCCAGTCAGACATTAGCTCGTAAATGCCATTAATATCTTTCAT
GATGAAGATGTCCAAATTTACATAAGACACAAAAGACACGAGTTCATTAAAGAAATCTTA
AACACTCACATTTACAAGAGTCAAGAATTGAAAGGCAGAGATTTTGCCATGCCATCTATT
AAAGCCATTAAAGGAAGTGAAAAATAATACACTTTCCTAGATTCAATGAGCGACAAAGAA
ATGATGATGGATGTAGACTAGAGAGAGGATCCTAAAGTCCATAACGATGAACTGCTTGAG
GAGTTGGTCAATGTCATTTGTGAGAGTGAAGTGCTTAGATGCCAAATTAACGATGTCACA
AGATAGGAGTTGATAGAAGATAACTTTGACTTCAGAGAGATCAAGGAAAAGTACAACTTC
GGATTGCAATCTACTAATGGAATCTTGAAGCACGATTCAAACACAGCACTTGGCACAGCC
GCTTCATCTCAAGTTTCGAGATTCACTTCAAACGATGCAGATGACAATTCAAACATCGCA
GACATTAAACGCATCCTTATCCAAGAGATTGGTGAAGATGATTTCAACTATCTCTACCAA
AAGAAAAGCAAACTCATCATGAAAACAATCAATGATGGCATTGAGAGATAGATGGTTCAG
CAAAACCTTGAGTTTTACAGCAAGGAGCAGTCAAGAAATAACTACAAGCTATTCGTTGCT
AATTAAATTGCAGAGAAGAAAAAGAAGCAAGAATAAAAGAAGAAAAAGACTAAGCTTCAA
GGCTACAAGCTTGGATTCACAGCTGATTAAATCAAAGAGAGAATTATGAGATTCATGGTG
ACTTTCAACTAAAATCAAGACGATGAAGATCAAATTTTGGAGACTAGACCAAGAGCTTTT
TCCCAGGAAAACATCAGAGGTGATCAATCTGAGATGCTAGAAACTAAAAGTATGATGAGT
TAAGGTTTTGCACTAAGTCAGTTCAACTACAAGAAGAACTTTTTCAAGGATGACGAGACA
GAATCAGAAAGAGAAGAAGACATGACCATGAATGTCGATCAGCATTAAAACACAGTGATT
GTTCTTTCTCAAATCAAGCCAACAATGAAATTGTTCTAAGAATATATTGATTGGTTTAAA
CAAAACGAAACAACAACCCAATTCAAGTTTGATCTCTTATAAGAAACTTAGAAAAGAGAA
CAGGAAATTTTACAGTAGCAAGAACTTGAGAGACAGCGCATCATTTAAAAACAAGAGCAG
GAGTAGAGTATTGCAAGAGCAAGATCTCAATCAAGGCAAATTGAAAACTAAAAGAAAATG
GAAGAGCGCTAGAGAAGAGAAGAAGAAGCTAGAAAGAAAGAAGAGGAAAGAAAGGCAATT
CTAAGCAAGAATAAAGAAGACAGATTGGCCCAAAGAAACAAGAGAGCGCTTGTTTCAGAC
AGCGAAAGTGATAAAGATGAAGAAATGATTGAAGAAGAGCAGCAAGATAAAATTCAATCA
TTTAAAGCCGCAAAGCAAATCACTACAGCACAAGTCATAGTGAAATCAAATACTCAAAGT
CAAGAATCATAAGTTAGCTAACAATCAATAAAGCTTATTACTTAAGACATCAAATTACCA
TAAATTGTTAATCCACCCACAGAGCATAAGCCATCATAATAAAGTCCCTTATCATTGAAG
AGTCAAAGTGAATCTGACAGCGATGACTTTGAAAATGAAAAACTTAGTAAAATTATAGCC
GCAACTAATTTATTCCAAAAGATCACACCAGCACCAGTCACTTAAAAGCTTGATATCAAG
TAATCCTTGGATAAAATCGCTGAACAAAAACAAAATCAGCTGTTTTAAGAAGATAGTGAA
ATGGTTGAAGAGCAAGTTCATGAAGAGGAATTTCCTATTGATGAGAGATTGAACAATTTA
GACTATATTCTAGGAAATCAAGTGGTTTAAGAAACTAAGAAAGAAGTAATTATAGTTCAT
TCAGAAACTGAGCAGGAAGAAGAAGATGAAGAGTCATTTTAAGATAAAACTCATGCTCAA
AATAACTAGTAACCTTCAGATTATGAAGAAGAGGAAGAACAGTTGGAAGAGCAGTAAATG
TTTAACATTTAAGTTGAACAAGAAATTCCAATGTCTCCAACGCTTGGTTATCAAGAAGAG
GAAGAAGAGGAAGAAATTATCTTAGAGGAGAGAAAGCCAGAAACCCCAACTCATCAAGTT
GAAATATGCACCTTTAACGAAGTTCCACAAGAAACAAGAAGTCAAGAGAACTTATTCGGA
CAATAAGATCTCCAAGATAACTCAGCAAGCAAGGCATCATTTATTGAAAGTGCAAATTTA
ACTTAAATTAATGAGGATCAGATAATTGAGATAAAGCACATTCAACATGAAATCCAAAAG
CTAGTTGAAATCCAACAAGATTAGTTGGCATCACCCATCAAATTTTATTAAGAACCAGTA
GAAGAAAAGGAAATAGCTAAAGAAGATGTTTAAGTTGGCTTTGTACCTTTTCAAAGACTA
TCTCAACAGCAACAGTAAATCTAAATGAATTCTCCAGTAAAAGAAAGCAGTCAGGAGGTT
TAAATGGAAAGACATTAATTCAACACCCCTGAAATGGAGAACTTTGCCATGATGTACCCA
TAGTACTACTATCCTTAAGCAGCTGCTAACTACATGATGAACTAATAGTAAATGTAGCAA
AATAACCTCTCCGCTCAAACACCTGTGAGACAAGAAATTACTCATTAAACCTAGTAAACT
ACGTCTCAAATCAATTCTCAGTCACAAACTAAGCTCCTCGCTTCTTCACAGCAATAGATT
TAGACTCATTAAGAAATCATGAGTGACACATCAGTTGATATTAACAAATAGGCACAGTTA
TAGCATCAAATTGTTAACTAGAAATGGATCATTACAGAATCAAGCAGAAACAAGAAAGAT
AAGAAGAGCAAGAAGAAGCATTCTCACAAGAAAATCATAAAAAAGCTGTATACTCATGAT
GCATACTCAGATGATGAAGTCGATGCTGATGATGAAGATGAAACCAGTCAAGATGAAAAG
TTAAAGAAGAGATAGTAAAAGGAAAAATCTAAGGCAAATCAATAAATGCAAAACTAATTT
AACGCAAATTAAAACATAGGAGGACTCACAAGTATGGCATAAATTGCTGCCCATGTTGAA
ATCCCATCTCACATTAGACCTTAACAACAGCAACATATGAATTAATAGTACGCTTAACAT
AATATTGTACCTTAGCAGTAATTGCCTTCAGCTCAGAATTTCTTGCAACCCCCTATGAAC
CCTGCTCTTATGAACAACGGTCCTTATCCAATGCCATAGATGAACCCAAACGGCTAATTC
CATCCTCACTTTAACCCATACAACTTCCAACAATACTAGCTTTAAATGAATCAAATGATG
CAGCAACAAATGAACTAACAAGTTCCTCATCCTATGAATCTAGCTCCATAAGTACTTCCT
CAACCAAAACCTCAGGCCATGAACAATCAAGCTCAATAGTAACTTCAATAGCAATAATAA
GCTGCCTAGCATGTCCAACTTCCCTCTATAAGTTAGGTTGTGCAATAAAAGCAAGTCCCT
TAATCTATCTAGTAAGCTTAATCTTAAAGTAACAACATGAAGTTCAGTATTCCTGTACAA
TAACAGCCTACAATGAAAACCGTTGCTGCTGCACCCCCTTCTAACCTTAATAGCTTCCTT
GATAGTATTCCAAATTCAGATAATCTTTCCCCAGAATAAAGCATGGAGCTTATTAAATAG
CTCAAGGAACTTCAGTATTTAACTTAACTTAGTTAGGCAAACAAAAGAATCAAGAAATGA


>Contig1486.1.g68(protein)
MTTSYLFENERLKPIIASYINSNFDFEAIPLNLRKHMRLSVQENIATFWVNDGFHFLEAQ
FTKDAINEFRKSYSHIKFQSLKGGIMFISKWSLKIKECDSRKVYTSYQNMQIQLVIESFK
PLLHEKPVRHQLVNAINIFHDEDVQIYIRHKRHEFIKEILNTHIYKSQELKGRDFAMPSI
KAIKGSEKQYTFLDSMSDKEMMMDVDQREDPKVHNDELLEELVNVICESEVLRCQINDVT
RQELIEDNFDFREIKEKYNFGLQSTNGILKHDSNTALGTAASSQVSRFTSNDADDNSNIA
DIKRILIQEIGEDDFNYLYQKKSKLIMKTINDGIERQMVQQNLEFYSKEQSRNNYKLFVA
NQIAEKKKKQEQKKKKTKLQGYKLGFTADQIKERIMRFMVTFNQNQDDEDQILETRPRAF
SQENIRGDQSEMLETKSMMSQGFALSQFNYKKNFFKDDETESEREEDMTMNVDQHQNTVI
VLSQIKPTMKLFQEYIDWFKQNETTTQFKFDLLQETQKREQEILQQQELERQRIIQKQEQ
EQSIARARSQSRQIENQKKMEERQRREEEARKKEEERKAILSKNKEDRLAQRNKRALVSD
SESDKDEEMIEEEQQDKIQSFKAAKQITTAQVIVKSNTQSQESQVSQQSIKLITQDIKLP
QIVNPPTEHKPSQQSPLSLKSQSESDSDDFENEKLSKIIAATNLFQKITPAPVTQKLDIK
QSLDKIAEQKQNQLFQEDSEMVEEQVHEEEFPIDERLNNLDYILGNQVVQETKKEVIIVH
SETEQEEEDEESFQDKTHAQNNQQPSDYEEEEEQLEEQQMFNIQVEQEIPMSPTLGYQEE
EEEEEIILEERKPETPTHQVEICTFNEVPQETRSQENLFGQQDLQDNSASKASFIESANL
TQINEDQIIEIKHIQHEIQKLVEIQQDQLASPIKFYQEPVEEKEIAKEDVQVGFVPFQRL
SQQQQQIQMNSPVKESSQEVQMERHQFNTPEMENFAMMYPQYYYPQAAANYMMNQQQMQQ
NNLSAQTPVRQEITHQTQQTTSQINSQSQTKLLASSQQQIQTHQEIMSDTSVDINKQAQL
QHQIVNQKWIITESSRNKKDKKSKKKHSHKKIIKKLYTHDAYSDDEVDADDEDETSQDEK
LKKRQQKEKSKANQQMQNQFNANQNIGGLTSMAQIAAHVEIPSHIRPQQQQHMNQQYAQH
NIVPQQQLPSAQNFLQPPMNPALMNNGPYPMPQMNPNGQFHPHFNPYNFQQYQLQMNQMM
QQQMNQQVPHPMNLAPQVLPQPKPQAMNNQAQQQLQQQQQAAQHVQLPSISQVVQQKQVP
QSIQQAQSQSNNMKFSIPVQQQPTMKTVAAAPPSNLNSFLDSIPNSDNLSPEQSMELIKQ
LKELQYLTQLSQANKRIKK