Identifiers and Description

Gene Model Identifier

Contig11834.0.g57

Standard Name

bTEBP2

Aliases

Contig11834_0_g57

Description

Telomere-binding protein beta subunit (TEBP beta)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam07404 ) Telomere-binding protein beta subunit (TEBP beta)
  • ( pfam11509 ) Protection of telomeres protein POT1
  • ( pfam09288 ) Fungal ubiquitin-associated domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11834.0.g57(coding)
ATGATTACAACCGCATCCTCAAACAGCAATCCCGCCAAATAAGCAAAGTCTTCAAGCGCC
TTCAAGACTCTTTTCAATGAGCTCTTATCGAACTAAGGAGACTACAACAAACTTCCTGAT
AACCTAAAGAGAGCTAAGATTAGATGCCAAGTGAGAGAGACATACCCTAAGCTATTGATT
TCAGATGGATCATTCTTTATCGCAGGTTACATAACCAAAGAATGCCAAAACAAGTGTGAA
CAAAAGAAAGTCAAGATCACGGACCTCAAGGATGGACTTATTTTAATTACTAAATGGAAT
GTTGAACTTACATTAGTTAATTCAGCTGAAGAATTCACTAGTTATAGTGGAATCGAAATG
AGAGTAATAATTCATGAGTTTAGAGTTAATCAGGAGGAAGATCTTAAGATGTCAAAATTC
CCAACAAATCTTTACAGAGATGATGAAGTTAAAGCTTCAATTTTGCACTTTATTTAAGCA
CAAAGACTCCAACAATTAAATAATTTGGTGGCTTAGGATAAGGAGATTAGTTTAGGTACA
ATTTTAGCTAAGCCAAAAACCAAGACTGAATTGAATGAAAGTCTACTAAGAAGCAATAAT
GTTATTAGCCTATCAGGAAAGAAAGTTGATGTTTCTGCAGATTGTGATTAATTCACGGAT
TTTGGATTTGATAAAGCTAAAAGAACTCCAGTTTTGACAATGCAAGAAATCTTCATAGCT
GAGAAAGGCGCAGAAGCCCTTAGAAAACTAAATATCAATCTTTAAGTCCAAAGATAAAAG
GATGAGCCTTAGCATGCTAAAGGGAAAAGGCAGACTACATAAGATCTTCAAAATGATCAA
GGATAAGATGAAATCTCAGTAGGTAAAGTCAAGAAGTCACTTACTGTATCTAAGCCAAAA
GAAACAGGAATCTCTAAGTTAAAAGTTACCACTACTTTCTTGAAAGATGAACCAAAACCA
AAAAAAACAGGGAAAGCAAATAAGACTAAAGCAATTGCTAAGAAGGGAGGTAAGAAAATC
GTAAAAGTAGTAAGAAAACTCAAAACAAAGATTGCTTCTGGGGTTAAAGGAAAAACACAA
AAGAGAGCTGTAAAGCTAGTTTCAAAGAAAGATCAATCATCAACGAAACTTACTGTCAGT
AAACTCAGAAAGATGCTAGAGGAAGCAGAAGCTGCAGAAAATGCAAAGAAATCATAAAAA
GCTTAACCAGCTAGAACTACTAGATCAGGAAAAGCCTCAGCAGTCCAGACTCCTTCTAAA
AAGAAATGA


>Contig11834.0.g57(protein)
MITTASSNSNPAKQAKSSSAFKTLFNELLSNQGDYNKLPDNLKRAKIRCQVRETYPKLLI
SDGSFFIAGYITKECQNKCEQKKVKITDLKDGLILITKWNVELTLVNSAEEFTSYSGIEM
RVIIHEFRVNQEEDLKMSKFPTNLYRDDEVKASILHFIQAQRLQQLNNLVAQDKEISLGT
ILAKPKTKTELNESLLRSNNVISLSGKKVDVSADCDQFTDFGFDKAKRTPVLTMQEIFIA
EKGAEALRKLNINLQVQRQKDEPQHAKGKRQTTQDLQNDQGQDEISVGKVKKSLTVSKPK
ETGISKLKVTTTFLKDEPKPKKTGKANKTKAIAKKGGKKIVKVVRKLKTKIASGVKGKTQ
KRAVKLVSKKDQSSTKLTVSKLRKMLEEAEAAENAKKSQKAQPARTTRSGKASAVQTPSK
KK