Identifiers and Description

Gene Model Identifier

Contig22260.0.g8

Standard Name

bTEBP1

Aliases

Contig22260_0_g8

Description

Telomere-binding protein beta subunit (TEBP beta)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam07404 ) Telomere-binding protein beta subunit (TEBP beta)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22260.0.g8(coding)
ATGAGCAAATCACAACAAGTTCAACAACAAAGCGCCTTCAAGCAACTCTACACCGAGCTA
TTCAACAACGGTGGTGACTTCGGCAAGGTCTCAAACAACTTAAAGAAGCCATTGAAGTGC
TACGTCAAAGAATCATACCCACATTTCCTTGTTACCGATGGTTATTTCTTCGTGACCCCA
TACTTCACCAAGGAGGCCGTGACTGAATTCCACTCTAAGTTCCCCAACGTAAACATCGTC
GACCTCCACGACAAGGTTATCGTTATCAACAACTGGTCACTCGAGCTCAGAAGAGTCAAC
TCAGCTGAGGTTTTCACTTCTTATGCCAACCTTGAGGCCAGACTCATCGTCCACTCATTC
AAGCCAAACCTCCAAGAGAGACTCAACCCAACCAGATACCCAGTCAACTTGTACAGAGAC
GACGAATTCAAGACCACCATCCAACACTTCAGACATCAAGCTCTCCAACAATCACTCGCC
AAGAACCTCAAGCAAGAGAACATTCCAGATATTGCCAAGGTCACTGGTGGTGACAAGAAG
GCCAAGGTCGATGCCGGTATTGTCAGAGCCAGCACCTCCAAGGGTGACGAATTCTCCGAC
TTCTCATTCAAAGAAGGCAACACTGCTACCATCAGAATCCAAGACATTTTCGTCCAAGAA
AAGGGCAAAGATGCTCTCAGCAAATTAGGCGGAGAAGGAGACGTAAAGGTCAAGGGTGGT
GCCAGAGGTAAAGCAAAGGCTGCCTCTAAATCAGCTGCCAGAGGAAAGAAGGGTTCAGCC
AAGAAGGCCGACGTTGGTGCTTCAGCCGATGTCAGAAAGAGCGTTGACAAGATCGTTAAG
TACACTCCCAACAAGCCATCAAGCAGAAAGGAGACCCCACAAAAGAGTCAATCAGTCCCA
GCTGGTAAATCATCTGCCAAGAAGACCACCACTGGTTCAAAGAAGACCCTTCCAGCCAAC
CCATCCCCAAGTGGAAAGAAGTCAACCAAGACCACCGATCAAATGACCATGGCCCAATTC
AAGAGATACCTCGAATGGCACGAAAAGAAGAATGTTGGCAAGACCTCATCAGGCGGCAAG
GTCCTCGGAAAGAGATCCGCTGGTAAGGCTTCAGCCACCTCCGGCAAAGCCTCCAAGGCC
TCAAAGAGATCAACCAAGAAATGA


>Contig22260.0.g8(protein)
MSKSQQVQQQSAFKQLYTELFNNGGDFGKVSNNLKKPLKCYVKESYPHFLVTDGYFFVTP
YFTKEAVTEFHSKFPNVNIVDLHDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSF
KPNLQERLNPTRYPVNLYRDDEFKTTIQHFRHQALQQSLAKNLKQENIPDIAKVTGGDKK
AKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIFVQEKGKDALSKLGGEGDVKVKGG
ARGKAKAASKSAARGKKGSAKKADVGASADVRKSVDKIVKYTPNKPSSRKETPQKSQSVP
AGKSSAKKTTTGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKNVGKTSSGGK
VLGKRSAGKASATSGKASKASKRSTKK