Identifiers and Description

Gene Model Identifier

Contig433.1.g128

Standard Name

aTEBP5

Aliases

Contig433_1_g128

Description

Telomeric single stranded DNA binding POT1/CDC13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02765 ) Telomeric single stranded DNA binding POT1/CDC13

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003789909.997093137033517e-262hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig433.1.g128(coding)
ATGGAAAAGAAAAGAGGAAGACCATCTGGTTCAAAAAGTAAGAAAACTATATAGAAAGAG
GCTGAAGAGAAAGCTAGATTGGAAAAATTACAAAAGGAAAATGGTGGTGTCGATGTCTCA
AATATCCCCTAGCCGGCTTCAGCTCAACCAGCGAAACGAGGCCGCAAGCCAAACCACCAC
ACCTACCAACACTACAATAATCCAAACTAATCAAACGTCAACACCTCACTCGGCAACCCC
CAAAAACCCTTATCAGACCCATCTAAGAAGTACTATAAATCTAATTAGGTGCATGTGTAC
ACTGAGTTGGCTAAGACAAGTCTAGGGAATACGGAGTTATTCAACATTTATGGAATCGTG
ATTGACGCTACCTCCCCTCATATCAAATTAGGGGAAATGAATGCTGCTAGATAGTTCAAG
ACTCATTTGAAGATAATTGATCCCACTGTTTACCCTAGAGTTAATAACAGAGATAGTAGC
ATTAAGGATGATGTGAATTGTGCAATTGCAATTACAATATTTCATAAGAATCCTGAGTAT
TTACCTACTTTCAAACGAGTTGGAGATATAGTAAGAATACATAGATGTAATATTGGTTAC
TTCAAAGAAAGAAAGACTTTTTCAGTGATTATTCCATTTGGTAGTTCCTGGGTAACTTTC
GAGGGTAGAGAAAAGAAAGAAATCTTTGAAGACTAATAAAACTAGAAATCCCCTAAAAAC
CTTGAGGACTCGAAAGACATTGACGGGGACTAAATCATGGATTCCGATTCAGATGATGAA
TCAAAGAAAAAGAAGAAATAGCTTAGCGGTTAGAAACACGAACAAAGAATCAAGAATTTC
TTTGGATTAGGTGAAAATAAGTAACAGCCCAGTAATAAGATCGAGATAACTGCAAAAACC
AAAGAGGATTTGCTCTCATAACAAAGTTTAGTGGGTGAAGACTAAGAAGTCATGCCTCAT
TATCTGCCTATGAAAATTTCGAGTAAAGAGTACTCTATGGGGTTGGTTGATAGAGACATC
ATTAGGAAGTTGAGGAAGTGGGGTAATGAATACTTCAAGAATGAGTTTTTGTATGAAAAC
AACATGGTCATGACTTTATCTAAAGCTAGGGATATTATCAGCAATGAACTGATATCGGGG
TAGAGAAATGAACTGGCTGCTAAGGGATTCGATTTGATAGTGCAAATAGAATAAATCAAT
AATTTAGAGGTACTATAGAATGGAGACCAAAAAGTATTGATTAAGATCAGTGATCACTCT
TGTGGTGACTTTGACTTGTTTACAGTGTAAAGTTTATTACCAAAGAATCTCAAGAAAGGG
GATGCAATTAGAATTAAGGCAGCTATTCCTTCTTAAACTGAAAAGAAAAAGAATGCTTTA
GAAACCAAAGACAGCTCGAACATTATGCTAATAGATCCATCGTTTAAGCAAGCCTAATAC
TTCAACCAATCAATTGATAATCTTGAAGTAGACATGACACCAATGATATTAGGAGAAGTT
TAGCAGCATCATCACAATGAATACTCCCATTTGTACTAAATTTATGAAGAAGTGCTTGAG
AAGCCAGAAATTGCTTCAACTATAGGATAACTTTACATAGGTTACGAAGCAACTGATTTA
GCTGATATTTTGTATTAAAACCCTTCTCTCACTGGAACTCAATAAGAATAGCTCTATAGA
GTGCAGTGCTATGTACTAAACATACAGCCCTTAAATCTGTTGGAAATCTCACAAGTTTAC
TGCAACATCTGCTATTCAAATTATTCCTACAAGCAATTCCCTGGAGGATTAAGTGATGTT
TCCAATCTTCACTGTCCAAACTGCTAAAACGGCAATATGCAGGCAATTTATATGATTTAA
TTCCTAGTCAAGGACAAATCTCTCTATCACCTAAACGGTGCCATGAAAATGATTTTGTAC
ACTATGGATGAAGTATGCAATAAATTCTTCAATGGCATAGAACCTTGCAATCTATACAGA
GAGCAGCTTGCAAGACAACAGATCGAAAAATACATGAGACATTTGGTCAGATTTAATGTA
TATTTGGATGTAATTGTCGAGAGGAAATGTGCGCAAGGAGAAGTTGTACTCAAATTGGTC
AATTGCAAACTTAACAAACAATTTTGA


>Contig433.1.g128(protein)
MEKKRGRPSGSKSKKTIQKEAEEKARLEKLQKENGGVDVSNIPQPASAQPAKRGRKPNHH
TYQHYNNPNQSNVNTSLGNPQKPLSDPSKKYYKSNQVHVYTELAKTSLGNTELFNIYGIV
IDATSPHIKLGEMNAARQFKTHLKIIDPTVYPRVNNRDSSIKDDVNCAIAITIFHKNPEY
LPTFKRVGDIVRIHRCNIGYFKERKTFSVIIPFGSSWVTFEGREKKEIFEDQQNQKSPKN
LEDSKDIDGDQIMDSDSDDESKKKKKQLSGQKHEQRIKNFFGLGENKQQPSNKIEITAKT
KEDLLSQQSLVGEDQEVMPHYLPMKISSKEYSMGLVDRDIIRKLRKWGNEYFKNEFLYEN
NMVMTLSKARDIISNELISGQRNELAAKGFDLIVQIEQINNLEVLQNGDQKVLIKISDHS
CGDFDLFTVQSLLPKNLKKGDAIRIKAAIPSQTEKKKNALETKDSSNIMLIDPSFKQAQY
FNQSIDNLEVDMTPMILGEVQQHHHNEYSHLYQIYEEVLEKPEIASTIGQLYIGYEATDL
ADILYQNPSLTGTQQEQLYRVQCYVLNIQPLNLLEISQVYCNICYSNYSYKQFPGGLSDV
SNLHCPNCQNGNMQAIYMIQFLVKDKSLYHLNGAMKMILYTMDEVCNKFFNGIEPCNLYR
EQLARQQIEKYMRHLVRFNVYLDVIVERKCAQGEVVLKLVNCKLNKQF