Identifiers and Description

Gene Model Identifier

Contig979.0.g41

Standard Name

aTEBP4

Aliases

Contig979_0_g41

Description

Telomeric single stranded DNA binding POT1/CDC13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02765 ) Telomeric single stranded DNA binding POT1/CDC13
  • ( pfam00667 ) FAD binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig979.0.g41(coding)
ATGTACAAAGATAAGAGCATAGATCATGCTACTGTGCAATTCTTTTCAAATAACATAAAT
GAGCTACCTAGTGTCTATAAAGTTGGGGATATTGTTCGAATTCACAGAGTTAACGCTTCT
GATTATAAAGGGAACTTGTAATTAAACGCAAACCTACATATTCACACATCCTGGCTCATT
TTTAGTGGAAATCCTGAGTATTATCATTCTTACGAGCATCCCCTACCAGATCAAGGAAGC
AGCAATCTGAGCAATCCATCTCAATTCTCCAATCATAGCAATTTGATTGTAATAGCAGAC
AGTCCAGAGGAGGAAGCCGAACTTTTAAAATAACAAAGAGCTTTCAACCAGCCACCCAGC
AACTTCTTAGATTTGATAAGTTCAAACAGTTTAAACAGAGATGAAATGATGATGGATTCG
ATAGAGGTCATGGATTAGAGATATTACCCAATCGCTTCTTCACATAATAGTTACAGCTTC
AATGACAGGGAAAAGCAGATAATTGATGATTTAAGAAATTGGTCATAGAATTACTTAAAA
AGCGTGCAAATATACAGTACAGAGACTAATCCACAAACATAACCAATTTACCAAAACAAT
GAAGGTAATCCCTATTTCAATGACTTTGACATAATGGCAAAACTTATATCAGTAAACGTC
TTAGATTCAATATTTACAATTATAAAAATGAAAGATTTAGCTGGAATAGTCTACTAATTA
AAAGTGAATACAAGTAGACATAAAATTCCTTAAAAAGGCTAAGTTATAAGAATAAGATCA
GCCAAAGTATTTGATGCTTATTAAGCTAATGTGAAAGGCAACAGTGAAGATCCTGTGATT
ATACAATTTCACAACCCATCTAACATCCTTCACATACCTGCTATTTACAAGCAAGCATTA
CTTATGAATGAGAGAGTCCTTGAAGATGATTTCTTAAAGAAACTCATTCTCAGCACCGAG
TAAGATAAGGATATAACAATGTGCTCCGATCCAATCGTCATTTCAAATGTTTCCTAGTAA
TATTCAGAAATGTATTTCACAACTTTGAATGAAGTGTTTCACATGCCAACTGGCTCATCA
AATTCTGCTTTTGATTACTGTTAAACGAATATCTTCAGAGTGAAAGTCTTTACACTAGGT
TTCATGCCAAATAACATCAGAGAAATGTGTTAACTTTATTGCAATAAATGTGTAAAAACC
TACTCTTTCCAAGAAATCGAAACAGATAACACCTTGCCTTTAGATAAACAGCCCTATATG
TGCCTGTCTTGTGGCGATTAATGCAAGTCAATCTATATGATAGTGCTTGTGGTTAAAGAC
GACTCAACTTCCTACAATGATAAATGTTACAAGCTGTATTACTACAGTCACGACCAGTAA
GAAGGAGATGAACTCTTCGGTGGTCTAAAAGCCTCAAATCTCTATAAAGATACCTAAACC
AGAGATATGTTGGCCATGTACATTTAGACGTTTACTAAATTCAATGTACACCTAGATTTA
GTCATTAGACGCAAATTCTCTGAGCAACTAAATGAAAACGTATATCAAATAATTGATGGG
AAAACTAAGGCTTTTCACTTGGAATTACTTTAAAATTAGCAATTTCAGTAAAAGTATCAA
CAAAAACTACAGAATGAGTAAATGTTGAATTAAGAGCAGATTGAAGAAAGAAAGAGATAG
GAGTTGAAGCGATACTTGGAACAATAAGCTTCAATTGATACCTAATTTAGAAATAATTAG
CAAGATTAATAGATGATGGAAATATGA


>Contig979.0.g41(protein)
MYKDKSIDHATVQFFSNNINELPSVYKVGDIVRIHRVNASDYKGNLQLNANLHIHTSWLI
FSGNPEYYHSYEHPLPDQGSSNLSNPSQFSNHSNLIVIADSPEEEAELLKQQRAFNQPPS
NFLDLISSNSLNRDEMMMDSIEVMDQRYYPIASSHNSYSFNDREKQIIDDLRNWSQNYLK
SVQIYSTETNPQTQPIYQNNEGNPYFNDFDIMAKLISVNVLDSIFTIIKMKDLAGIVYQL
KVNTSRHKIPQKGQVIRIRSAKVFDAYQANVKGNSEDPVIIQFHNPSNILHIPAIYKQAL
LMNERVLEDDFLKKLILSTEQDKDITMCSDPIVISNVSQQYSEMYFTTLNEVFHMPTGSS
NSAFDYCQTNIFRVKVFTLGFMPNNIREMCQLYCNKCVKTYSFQEIETDNTLPLDKQPYM
CLSCGDQCKSIYMIVLVVKDDSTSYNDKCYKLYYYSHDQQEGDELFGGLKASNLYKDTQT
RDMLAMYIQTFTKFNVHLDLVIRRKFSEQLNENVYQIIDGKTKAFHLELLQNQQFQQKYQ
QKLQNEQMLNQEQIEERKRQELKRYLEQQASIDTQFRNNQQDQQMMEI