Identifiers and Description

Gene Model Identifier

Contig7057.0.g98

Standard Name

aTEBP3

Aliases

Contig7057_0_g98

Description

Telomeric single stranded DNA binding POT1/CDC13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02765 ) Telomeric single stranded DNA binding POT1/CDC13

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7057.0.g98(coding)
ATGAAAGTTAATTATTTGCAGATCAAATTTAGATAGTCTTAGAACTTACCTTTCAAACAT
CCCAATATTTTTAGAATAGGAGATATCATTCGAGTAAACAGAGTGAATTGTCAAAAGTAT
GATAATTAAATCGACCTCATTAACGATAAGTAAACATCTTGGGCAATTTTTAGTGGCAAT
CCTGATTATTAGCATTCTTATGAACATGAAAAGAGTGACTTCAAATTGAATGTAAATTAT
TTTAAAAACTATGAAGAACTGAGTAATCTAGTTAAAATAACTGAAAGCGCAGAAGAAGAA
CTACAATTGCTCAATTATTAAAAAAGTTAATATGGGGGAGCTATTAGATATAAAGATTTC
GATATCTTAGCTCTACTAATATAAGTCCAATTGATAAAAGCTACAGAAGCTAAGCTTTTA
TTGAAAGATGTTTCCGGGAAAGTTTATGATATAATTGTTGATATAACTAGACATAAAATA
CCTTAGGAAGGTGAAATTGTGAGAATCAGGTCTGCTTGTCTAATAAAACCACCTGCTAAC
TATTCTTAACCCATATAGATTATGATCGAGAATCATTCAAACATTCTTCACATTCCTTAA
ATGTTTAAATAAGCAAAAATATTTAAAGAAAAAATTCAAGAAAATGAAGTATTTTCTTAA
CTCATGATCAGCTCTTAAAATGACAATGATACTGCTATTTGTTTAAAGCCATTTGTTGTG
ACAAAAGTTTCCAAATAGTATTCCAAAATGAATTTCTCAAACTTCACTGAAATTCATCAC
CACCCTAATGATCAATAGAACTCTGATTTAAATCCCTAATAAAATAATACTTTTAGAGTT
ATGGTTTAAACTCTTGATTTCTTGCCCTCAAATTTAGAAGAAATCATTCAGTTCCAATGC
CCTAATTGTATGAAACTTTATTCTCAGCAGTAATTTGTCTTATCATCTAGTAAAAACTTT
TGCTTTTGTATTCCTGCAGGTGTTTCATGCCAACAAATCTATACTTTCACTTTGATTGTT
AAAGACCAATCAACTCTTTATGACGATTAATGCTTTAAACTTTAGTATTCCAGTTTTGGT
CAAACTTAAGCACAATTGCTTTTCTCTGGCTTAAATGTAACAAACCTCTCTAAAGATTTG
TAAGCGAAATATCTAGTTGAAATGTGCCAGAACACCTTCACAAAGTTCAATGTGCATTTA
GACTTGATCATCTAAAGCAAGTATTGTGAGAATGAAGGAGTAAATGTATTTCAAATTGTG
GATGGGAGAGTGAAACCTAATTATTTAGAGTATTTTTAGAATCAGCAACTATATTAACAG
TAAGAAATTAATAATGAATTTGACAAACTAAACTTAAACTGA


>Contig7057.0.g98(protein)
MKVNYLQIKFRQSQNLPFKHPNIFRIGDIIRVNRVNCQKYDNQIDLINDKQTSWAIFSGN
PDYQHSYEHEKSDFKLNVNYFKNYEELSNLVKITESAEEELQLLNYQKSQYGGAIRYKDF
DILALLIQVQLIKATEAKLLLKDVSGKVYDIIVDITRHKIPQEGEIVRIRSACLIKPPAN
YSQPIQIMIENHSNILHIPQMFKQAKIFKEKIQENEVFSQLMISSQNDNDTAICLKPFVV
TKVSKQYSKMNFSNFTEIHHHPNDQQNSDLNPQQNNTFRVMVQTLDFLPSNLEEIIQFQC
PNCMKLYSQQQFVLSSSKNFCFCIPAGVSCQQIYTFTLIVKDQSTLYDDQCFKLQYSSFG
QTQAQLLFSGLNVTNLSKDLQAKYLVEMCQNTFTKFNVHLDLIIQSKYCENEGVNVFQIV
DGRVKPNYLEYFQNQQLYQQQEINNEFDKLNLN