Identifiers and Description

Gene Model Identifier

Contig20701.0.g60

Standard Name

aTEBP2

Aliases

Contig20701_0_g60

Description

Telomeric single stranded DNA binding POT1/CDC13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam02765 ) Telomeric single stranded DNA binding POT1/CDC13

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20701.0.g60(coding)
ATGCAAACATCTCACTAACCAGGGTCACCCACTAACGCCAACACACATGGTAGTCACTCA
GCTCAATAGTACAAAAAGCCAACCACATACTAGTACATGTCCATCAAAGACATTGCTCAA
GATCAAAATGCACAAACAGACACACAATTCTACTTCTTCGGTGTGGTCATCGATGCCGCT
TACCCATATAAGAATCAAAATGGAAGGTTCTTGTGTTCAGTCAAGGTTGTAGATCATTCT
TTCCATCACAAGGACAAGGGTGGGGAGTCAAGTAATTAATCACCTCAACATGCTACTGTA
ATCTTTTACGCAAAGAGATTTGAAGATCTTCCAATCATAAAGAGAATCGGTGATGTAATC
AGAGTTCACAGAGCCACGAAAAGAGAATACTAAGGCTAATTACAGTTCCATGTCAATGTT
TTTTTCAACTCCAGTTGGTGCTTATTTGAACAGTAGAGCTCTGGTGCTCTAAATGATCAA
GAAAATTAAATTAGTGACAATGACTCAGATGATAATGGAAACGGAAATGAGGATCAAGAA
ATGCTCGACGAAGAGCAGAGACGTGAAAGATAGCAAGAGAGAATCGAGAAGAGAAAGTAC
AAACCTTATAAATTTTCAGGTAAAAGTTACACATTCGATGTATCTCATGAGAAAGTGCAA
ATCGACTCTCTTAGAAACTGGGGAGAGGAGTACTTTAAAAACAATTACGTGATTACCAAG
GAGATGTACAAATTGCTTAAGGATGTAAAGCAGGATATCACATCTGACTAAAATAAGGAA
TTCGATCTCATCTGCAAGATCCTGAAAATCTTTGAGAAAGATGAAACTTCACTTGAAATA
AGAATCAAAGATCTCTCTTAAGAGATGTGGTTTATGAACGTACCTAGATTTAAATTCCAA
AACTTGAAATAAGGGGAAGTCATTAGAATAAGATGTGTGGAAGTCAATCTGACTTCCAAA
AGGAATGTCATCTAAACTAAGCAGTACACTAATATCTTAAGATTCAATCCTTAAGCAAGA
ATTGCAAAGGAACTTACTAAGAAAATCGAAAATGAAACTGACATGGATAAGGTTTTAGGA
GACGAAGCTGGAGATATTGTTATGAATGCAGTTATTCTTACTGAAATCACAGATGCTCAA
TTATCAAGGACTTAATGCTTCAAGATATCAGATCTCTTCATAGACTATGAGAAAATTCCT
GAAGATCTAAGAGAGAAAAATGCTTTCAGAGTAAGGTTTTACTGCTTGAGAATCGATCCA
CAAGATCACAGAGAAATAGTTCAAGCTTACTGTCCTTCATGCCATGAAACATTCTCTTGC
AAAGAATTAGATAAAGAAGGCAGGAGTAAATGCATTTCTTGCAAAGTAGAATGCAAATTA
ATATACAAAATGCAAATGCTTGTTAAGGATTCCTCATCACAAATGAATAAAAATTTCTAC
AGGATACTACTGTGCTCATTTGAGGAGGGTAAAGGCCACGATTTCTTCACTAATGTAAAG
CCATGCAACTTATATTAAAATCCTCAAGCTTTGGAATTAATAGAGAGACAACTTAAAGCA
ATGACTAAGTTTAATGTGTGGATCGATGCAATCATTGAAAGACAAGGTTCCTATTTCTTA
ATCAGAGATACTAAAATCTCTCAAATGATTAACTGA


>Contig20701.0.g60(protein)
MQTSHQPGSPTNANTHGSHSAQQYKKPTTYQYMSIKDIAQDQNAQTDTQFYFFGVVIDAA
YPYKNQNGRFLCSVKVVDHSFHHKDKGGESSNQSPQHATVIFYAKRFEDLPIIKRIGDVI
RVHRATKREYQGQLQFHVNVFFNSSWCLFEQQSSGALNDQENQISDNDSDDNGNGNEDQE
MLDEEQRRERQQERIEKRKYKPYKFSGKSYTFDVSHEKVQIDSLRNWGEEYFKNNYVITK
EMYKLLKDVKQDITSDQNKEFDLICKILKIFEKDETSLEIRIKDLSQEMWFMNVPRFKFQ
NLKQGEVIRIRCVEVNLTSKRNVIQTKQYTNILRFNPQARIAKELTKKIENETDMDKVLG
DEAGDIVMNAVILTEITDAQLSRTQCFKISDLFIDYEKIPEDLREKNAFRVRFYCLRIDP
QDHREIVQAYCPSCHETFSCKELDKEGRSKCISCKVECKLIYKMQMLVKDSSSQMNKNFY
RILLCSFEEGKGHDFFTNVKPCNLYQNPQALELIERQLKAMTKFNVWIDAIIERQGSYFL
IRDTKISQMIN