Identifiers and Description

Gene Model Identifier

Contig22209.0.g66

Standard Name

aTEBP1

Aliases

Contig22209_0_g66

Description

Telomeric single stranded DNA binding POT1/CDC13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam02765 ) Telomeric single stranded DNA binding POT1/CDC13
  • ( pfam05587 ) Anthrax receptor extracellular domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003789800.0000009995106777214876hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22209.0.g66(coding)
ATGTCATCAGCTGCAAAAACCCAAAGATCAACTTCAAGAGTCACAAAGAAGAAGACCACA
GGCCCCAAGGACGCTGCACCAAAGAAAGCCGAAAAGGGAAGCAAATACGAATACGTCGAG
TTAGCCAAGGCTCAATTGACATCAGTCACAGCCCAACACTTCTACGCTGTTGTTATTGAT
GCAACTTTCCCATACAAGACCAACCAAGAGAGATACATCTGCTCTCTTAAGATCGTTGAT
CCATCCCTCTACCTCAAGAAGGAGAAGGGAACTGGTGATAACAGCGATTACGCCACCCTT
GTCTTGTACGCAAAGAGATTCGAAGATCTCCCCATCATCCACAGACTTGGAGACATCATC
AGAATCCACAGAGCCACCATCAGACTTTACAATGGTCAAAGACAATTCAACGCTAACATT
TTCTACAGCAGTTCATGGGCTCTCTTCTCCACTGACAAGAAGTCAGCACTCCAAGAAATC
GGTGGACAAGAAGCTACTAGCGATCTCGTACCATTCTCTCACTCAGGCAAAAACTTCACC
TTCCAGAAGAATGAAGCTGGTATTGTTCAAAACATTAGAAAGTGGGCTCAACAATACTTC
ACCCAATACTCAGTTATCTCCAACGATATGTTCACTGCTCTTAACAAGGCTCAAGCCCAA
AAGGGAGACTTCGACGTTGTTGCCAAGATCCTTCAAATCCACGAGCTCGACGAATACACC
AACGAGCTTAAGCTTAAGGATGCCTCAGGTCAAGTTTTCTATACTCTTGCCCTCAAGCTC
AAGTTCCCACACTTGAGAACTGGCGAGGTTGTCAGAATCAGATCAGCTACTTATGATGAG
ACTTCAACCCAAAAGAAGGTCCTCCTCCTCTCTCACTATTCAAACATCGTCACTTTCATC
AGCACCTCAAAGCTCGCCAAGGAGCTTAGAGGTAAGATTACCGATGATAGAGCTGTCGAG
AAGGCTGCTCTTAAGCAAGACGTTAGCTTAAGCGCTGTTGTCTTGACTGAAGTCGACAAG
AAGCACGCAGGTCTCCCAGCCCACTCACTCCACGATCTCTTCCACAACGCTGACTCAGAC
AAGGAGCTCTCCAGCAAAGACACCTTCAGAACCCAATTCTACGTAACCAAGATTGAACCA
TCAGACGTCAAGGAATGGGTTAAGGCATACGATAGAAAGACCAAGAAGGTTACTTCCCTC
AAGGGATCAGCTGCCAAGGGTGGTGACAACATCTTCCAAGTCTCTTTCCTCGTTAAGGAC
GCTTCAACTCAATTGAACAACAACACCTACAGAGTTTTGCTCTACACCCACGATGGTCTC
GGTGCTAACTTCTTCAACGGTGTTAAGGCAGACAACCTCCACAAAAACGCTGATGCCAGA
AAGAAGCTCGAAGAATACTCTGAACTCCTTACCAGATTCAACTCCTACGTTGATGCCGTC
GTTGAGAGAAGAAACGGTTTCTACTTCATTAAGGACACCAGAATTGTCTACTGA


>Contig22209.0.g66(protein)
MSSAAKTQRSTSRVTKKKTTGPKDAAPKKAEKGSKYEYVELAKAQLTSVTAQHFYAVVID
ATFPYKTNQERYICSLKIVDPSLYLKKEKGTGDNSDYATLVLYAKRFEDLPIIHRLGDII
RIHRATIRLYNGQRQFNANIFYSSSWALFSTDKKSALQEIGGQEATSDLVPFSHSGKNFT
FQKNEAGIVQNIRKWAQQYFTQYSVISNDMFTALNKAQAQKGDFDVVAKILQIHELDEYT
NELKLKDASGQVFYTLALKLKFPHLRTGEVVRIRSATYDETSTQKKVLLLSHYSNIVTFI
STSKLAKELRGKITDDRAVEKAALKQDVSLSAVVLTEVDKKHAGLPAHSLHDLFHNADSD
KELSSKDTFRTQFYVTKIEPSDVKEWVKAYDRKTKKVTSLKGSAAKGGDNIFQVSFLVKD
ASTQLNNNTYRVLLYTHDGLGANFFNGVKADNLHKNADARKKLEEYSELLTRFNSYVDAV
VERRNGFYFIKDTRIVY