Identifiers and Description

Gene Model Identifier

Contig1856.0.g44

Standard Name

ZUCc

Aliases

Contig1856_0_g44

Description

PLD-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_021887205.001531130907917e-44hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1856.0.g44(coding)
ATGAAGAAGATACAGGACTAAGAAAGTAAACTATAGAAGCTAAGTGAAGACGAAAAAAGG
AAGGAAGAACATCTGAAGAAGAGGAAAGAAGCCTGGGAAGAAAAACTTAAATCTAAACAG
CAAAAGGAAGATTTGCTGAAGATGCAAAGGGAACTAGCTAGGCAAAAGTAAGAAGAAGTA
ATAATGAGTAAAAAGCAATACAAAGAAGAATTAAATACCAGTAAAACGCTGAATGATAAG
ATGACCAAGGAAGAGAAACGCTTTAAAGATTATGAATACCAGAGGAAAATAGAAGAATCT
AAAAAATAAAAATAAGAATACCAACAAGAGCAGAGAGAACTTGCCGAGAGAAAACAATAT
GAATTGGAAGAAAGAGAGAGGAAACTTAAAGAACAGTAGGATGAAAAGAAAATGCTTTTA
GAAAGGAAAGCATAGGAATAGAGAGAGTTGCATGAATAAAAGCTGAAATAAAAACAAGCT
AAAGCTTAAGAACATGAGCAAAAGAAAAAACTTGATGCTGAATACAAAATAAAAAGAGCA
GAAGATAAAATAAAGCAGTTTCATGATGAAAAGGAACAATAGAAATAAGAGAAATTAAGA
TTGGCATAGGAAAAAGAAGAAGAAATAAAAAGAGCCTAATATTAAAAGAACTCAATAATT
GAATTGAAAACCACGAAAGTATTGCAACAATTGAATCAAGGGGATTAAAGACTACAAAGA
CTAAAAGAAGAAAAAGAGAATCAAATAAGGGAAAAAGAACAGGCAAAATTAGAAAAGAGG
AGAGAACTTGAAATTTAAAAATCAATGTAAAAACAGCAATATGATCAGGATATATCATAG
CTAGAATCAAAAATAAAAGATAAAGAGAGAAGAGGAAAGGATGCTGAGAAATACAAAGTA
GAATTAGTTAAGTAAAGGAAAGAGCAAGAATAATTCATAAAGAAATAATTGCATGACAGG
AACATGCAGAAAGTGAAAGAACACAGAGCTTAAGAAGCTAATAAAGTACTCTCCAAGATT
TAATAAGTAGAGGAGAGACTTAATAATATCGAGAGTTCCAATTATCTTATTGATAAGAAG
GCAAGGGAGGATGATAAAAAGAGGAAGTTAAGGGAGGCATTTGAATTGAAAGAATAAAAT
CAAAAAAGACTAGAGGAGTTATAGGCTCAGAAAAACAGAGACATAGAGGAAAGAGAGCAA
AAGATCAAGGAACAAGTTGATAAGAAAAAGAGAGATCTTCAAGAACAGATCAAAGAGAAA
CAACAGCAGAACAATGAGAGATTAAAAGATAAGTTGTATAAAAAAGAAGAACTTATGAAT
ATGAAGTACTCAGAACTAAACAGTCATTTGCAAAGTGCAGAGTAAAAAAAGAAAGCATTT
GAAGAAGAGAGAGAACGTAGAATCAGAGAGGAGAGAGAAAAAGCAAAACTAAAGCAGCAA
GAAATGGATAGAATCTAGAAAGAAGTTGAGTAAAGAGATCAAGAAAGAAAGCAAAGAATT
CTTCATTCCATGGATGAAGCTGATTTTAGACTCAAGAAACTTGAAGACGAGAAGAAAGAG
AAGTAAAGACAAAGGAAAGAATAAGAAATGCTAAAGAGAATGGACAGAGACAGGTAGATT
TAATCTGCAGTTGAACTGAAATAGTAGAAGCTCAGTGAAGTACAGCAAAAGCTTGATTTC
ATGAATGATAAAGTCAACAATGTAATTAAGCAGAGAGATGACCAAATCAAAGACAAAAAG
GCAAGAGAAGATTTTGAAAGACAGCAGAAGATGTTCAATAAATCCAAGATGCAAGAGTCA
AAAGACAGAGAAAATCAAAGATTGCTGGAGAAGATGAAAGAGAAAGAAGACAGGTATTTG
AAACTCAAATAAGATAAGGATGAATACTCTAACGAAGATTCTTATCTCAACAGTGAAGAA
GAAGAAGATGAAGTAAGTTCTCTTGATGAAGAGTCTTATGAAGATGATGATTCAGAGGAA
ATTAACATAAAGGTAGAGAAAAGAAGCTTAAACAAGCTAGAGACTAAGATAGCTATGAGT
GGAAAGAGTAAAGTGACAAAGACATAGAAAAGGACTAAAGTAGAAAGTGCCACTGAAAAA
ACAGTATCAACTAAAAAGAGAGAAGTTAAGCAAACTACAAAACAAACAGTGAAAACTTAA
AAGTAGGCACTTAAAGAAGCTAAGCCACAAAAAGAAGAGAAGAAGACTCAGAAGTAAATC
AAAGAAGAGTTGAAAGAAAAGGAGAGATAAGATGATGCCATTGAAGATTAGATATACTTT
TACCAAGAATCCAATTTGATTAAAAATAAGAAAATATCTTAAGAAATTGGTCAACTTATT
AGGAATTTCAAAATCCAAAACAAAATTAACAAAGAAGCCTTATAACAACTAATATCTTAG
CATCACTTAAGCTTTCCTCAATCAAGCTATAACTTTTTAATGAAAAAGATTAAAAAGCAC
AGTAACTTACTTCAGCTATCACCATCTCTATGCTTTGAATTATTTGAGGCAGTAAGTTCC
CATGCTCTTCAATTAAAGCCATGCTTTTTGGAGTCTATGTTTTTCCCAAATAAATAAAAC
GAAAAAAGGCTTGCAGCTATATTGAGAAAGGCAAAGCAATCCTTAGATATTTGTGTGTTT
GCTTTTACAAATGATAGATTGAGAGATGCTATTCTTTACGCTTTTGAGAGAGGTGCAAAA
GTAAGAATAATCACAGATGATGAATGCTCTAAATTCATGGGTGCAGATGTTTATAGTCTT
GGAGAAAAAGGCATCCTTTGCACTATGGACAACAATAAGATGGTCCACATGCATAATAAA
TTTGCTATAGTTGATAGTTTAGTTCTAGTAACTGGATCCTTCAATTGGACTTCATAAGCA
GTCAATATGAATTAAGAAAATTTGATTGCTATTTAGAATTAGCATTTAGTAGATGAATAC
CAACAAGAATTTGAAAAATTATGGATTTAATTTGCTTGCAATAGACTCAGTGTTGCTGAC
TGTACCAGGAGATTGTAGGAAGAGGAGGTTAATAAATAAGTTAGAATCCAGAAAATGAAT
GACGGCAGAAAATAAAAGCAAGCTGAAAGGATACAAGCTAAAACTGAACTATGA


>Contig1856.0.g44(protein)
MKKIQDQESKLQKLSEDEKRKEEHLKKRKEAWEEKLKSKQQKEDLLKMQRELARQKQEEV
IMSKKQYKEELNTSKTLNDKMTKEEKRFKDYEYQRKIEESKKQKQEYQQEQRELAERKQY
ELEERERKLKEQQDEKKMLLERKAQEQRELHEQKLKQKQAKAQEHEQKKKLDAEYKIKRA
EDKIKQFHDEKEQQKQEKLRLAQEKEEEIKRAQYQKNSIIELKTTKVLQQLNQGDQRLQR
LKEEKENQIREKEQAKLEKRRELEIQKSMQKQQYDQDISQLESKIKDKERRGKDAEKYKV
ELVKQRKEQEQFIKKQLHDRNMQKVKEHRAQEANKVLSKIQQVEERLNNIESSNYLIDKK
AREDDKKRKLREAFELKEQNQKRLEELQAQKNRDIEEREQKIKEQVDKKKRDLQEQIKEK
QQQNNERLKDKLYKKEELMNMKYSELNSHLQSAEQKKKAFEEERERRIREEREKAKLKQQ
EMDRIQKEVEQRDQERKQRILHSMDEADFRLKKLEDEKKEKQRQRKEQEMLKRMDRDRQI
QSAVELKQQKLSEVQQKLDFMNDKVNNVIKQRDDQIKDKKAREDFERQQKMFNKSKMQES
KDRENQRLLEKMKEKEDRYLKLKQDKDEYSNEDSYLNSEEEEDEVSSLDEESYEDDDSEE
INIKVEKRSLNKLETKIAMSGKSKVTKTQKRTKVESATEKTVSTKKREVKQTTKQTVKTQ
KQALKEAKPQKEEKKTQKQIKEELKEKERQDDAIEDQIYFYQESNLIKNKKISQEIGQLI
RNFKIQNKINKEALQQLISQHHLSFPQSSYNFLMKKIKKHSNLLQLSPSLCFELFEAVSS
HALQLKPCFLESMFFPNKQNEKRLAAILRKAKQSLDICVFAFTNDRLRDAILYAFERGAK
VRIITDDECSKFMGADVYSLGEKGILCTMDNNKMVHMHNKFAIVDSLVLVTGSFNWTSQA
VNMNQENLIAIQNQHLVDEYQQEFEKLWIQFACNRLSVADCTRRLQEEEVNKQVRIQKMN
DGRKQKQAERIQAKTEL