Identifiers and Description

Gene Model Identifier

Contig13107.0.0.g78

Standard Name

ZUCa

Aliases

Contig13107_0_0_g78

Description

PLD-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam13091 ) PLD-like domain
  • ( pfam07894 ) Protein of unknown function (DUF1669)
  • ( pfam00614 ) Phospholipase D Active site motif
  • ( pfam11655 ) Protein of unknown function (DUF2589)
  • ( pfam00612 ) IQ calmodulin-binding motif
  • ( pfam03320 ) Bacterial fructose-1,6-bisphosphatase, glpX-encoded

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_021887205.997992534675281e-52hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13107.0.0.g78(coding)
ATGGAAGCTAAGGAGATCGACATGCAAGACTTCTCTAGAATCCTTACCAAGATGCCATTC
AAACAGCACAAAGATACCGTAAATGCAGTCATTCAAAAACTTTTCGAAGTTGCAGGTGGA
AAGATGAAGGATGATCATGATAAGGCAGTCATTGAAGGTTTGAAGAAGTATGTCTTGGCC
GCTCAAGACGACCTCCTCCAAACTAAGCCAAGATACATGGACGCCTTCTTCTTCCCCAAC
GAGAAGAATGTCGACAAGCTTGTAGGATACTTGACCAAGGCCACCAAGAGCATGAACATC
TGCGTTTTCAATCTTACCAACGATCGCCTAGCCAACGCCATTTTCGATGCCCACCAACGC
GGAGTTAAGGTTAGAGTCATCTCTGACGACGAGTGCATGGAGAACCAAGGTTCAGACATC
AAGTGGCTCGCTGGACAGGGAGTGCCATGCAGAGTCGACAGCGCTTCTCAATTCCACATG
CATAACAAATTTGTTGTCATTGATGACACCTTCCTCATTACTGGTTCATTCAACTGGACC
GTCCAAGCTGGAAAGAGCAACTAAGAAAACATTTTGGTTGTTGACCACACATATTACATT
GAAAAGTACAACACTGAATTCGAGTCCCTCTGGAAACAATTCGCTTCCAACGAAGTGAAA
GGCGAAGAAGAGGAGCAAGAACACGCCGCAGTCAAAATTCAAACTGCCTTCAGAGCTAAG
AAGCAAGGCGGACAAACCCAAGGTGGTTTCCAAGGTGGTGCCAAAAAATACAACAATTGA


>Contig13107.0.0.g78(protein)
MEAKEIDMQDFSRILTKMPFKQHKDTVNAVIQKLFEVAGGKMKDDHDKAVIEGLKKYVLA
AQDDLLQTKPRYMDAFFFPNEKNVDKLVGYLTKATKSMNICVFNLTNDRLANAIFDAHQR
GVKVRVISDDECMENQGSDIKWLAGQGVPCRVDSASQFHMHNKFVVIDDTFLITGSFNWT
VQAGKSNQENILVVDHTYYIEKYNTEFESLWKQFASNEVKGEEEEQEHAAVKIQTAFRAK
KQGGQTQGGFQGGAKKYNN