Identifiers and Description

Gene Model Identifier

Contig1475.1.g54

Standard Name

ZNRD1b

Aliases

Contig1475_1_g54

Description

Transcription factor S-II (TFIIS)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01096 ) Transcription factor S-II (TFIIS)
  • ( pfam09526 ) Probable metal-binding protein (DUF2387)
  • ( pfam12760 ) Transposase zinc-ribbon domain
  • ( pfam08274 ) PhnA Zinc-Ribbon
  • ( pfam04032 ) RNAse P Rpr2/Rpp21/SNM1 subunit domain
  • ( pfam09723 ) Zinc ribbon domain
  • ( pfam05129 ) Transcription elongation factor Elf1 like
  • ( pfam05876 ) Phage terminase large subunit (GpA)
  • ( pfam11792 ) Baculoviridae late expression factor 5 C-terminal domain
  • ( pfam13465 ) Zinc-finger double domain
  • ( pfam04828 ) Glutathione-dependent formaldehyde-activating enzyme
  • ( pfam02150 ) RNA polymerases M/15 Kd subunit
  • ( pfam08209 ) Sgf11 (transcriptional regulation protein)
  • ( pfam04957 ) Ribosome modulation factor
  • ( pfam01396 ) Topoisomerase DNA binding C4 zinc finger
  • ( pfam10571 ) Uncharacterised protein family UPF0547
  • ( pfam08271 ) TFIIB zinc-binding
  • ( pfam11781 ) RNA polymerase I-specific transcription initiation factor Rrn7
  • ( pfam13717 ) zinc-ribbon domain
  • ( pfam13719 ) zinc-ribbon domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR063W0.000000000000006999063783600386RPA12 SGDID:S000003824, Chr X
from 555195-555572, Genom...
T. thermophilaTTHERM_010161000.000000000000008002679274403579transcription factor S-II (TFI
IS)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1475.1.g54(coding)
ATGGCTGGTTAAGACCTAGTTGGTAATCAAGTAGTAACCAGGAAGCAACTAACTCAAAGA
AAAGAATGGTTAGAAGGTTACCAGGAAGCCACTAAGAATGAGAGGCCCACAGTACAGGAA
GACTGCCCTAATTGCGACAGCGATTTAATGTACTATCACACCATGCAATTGAGAAGTGCT
GATGAAGGTCAGACTGTGTTCTTTGAATGTGTCAAGTGTGGTCATTAATTTAAACATAAT
ACATGA


>Contig1475.1.g54(protein)
MAGQDLVGNQVVTRKQLTQRKEWLEGYQEATKNERPTVQEDCPNCDSDLMYYHTMQLRSA
DEGQTVFFECVKCGHQFKHNT