Identifiers and Description

Gene Model Identifier

Contig10554.0.g23

Standard Name

ZNRD1a

Aliases

Contig10554_0_g23

Description

Transcription factor S-II (TFIIS)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR045C3.998395524589391e-34RPC11 SGDID:S000002452, Chr IV
from 548310-547978, Geno...
T. thermophilaTTHERM_004442500.0000000000005000841553255702hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10554.0.g23(coding)
ATGTTATTTTGTCCAACATGCGCAAATCTCTTATTGATAGAGAAGACTCACAATGATTTC
AGGTTTTTCTGCAAGACTTGCCCTTACGTGTTCGTAGTTGAATAGAACTTTGAAAAGAAA
ATGCAATTGGAGAGAAAAGAAGTTGATGATGTACTCGGAGGTAAAGAGGCTTGGGAGAAT
GTCGATTAAATTGAAGCGGAATGCCATAAGTGTGGAAATAGAAGGGCTTATTTCATGCAG
ATACAGATCAGAAGTGCAGATGAGCCCATGACTACATTTTACAAATGCACGAAATGCAGT
TATCAATGGAGAGAAAACTGA


>Contig10554.0.g23(protein)
MLFCPTCANLLLIEKTHNDFRFFCKTCPYVFVVEQNFEKKMQLERKEVDDVLGGKEAWEN
VDQIEAECHKCGNRRAYFMQIQIRSADEPMTTFYKCTKCSYQWREN