Identifiers and Description

Gene Model Identifier

Contig19988.0.g81

Standard Name

ZNF622b

Aliases

Contig19988_0_g81

Description

C2H2 type zinc-finger (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001379208.002082816694397e-20Zinc finger, C2H2 type family
protein
SGDYLR387C0.0000000000019997478866288316REH1 SGDID:S000004379, Chr XII
from 897672-896374, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19988.0.g81(coding)
ATGTTATAAGCATCTAATATTCAAAATCCTACTGCAAGCTCTGCATTAAGCAACCCATAC
TCGCAGAATCAAGATAAGCAGGTGATCTGTTCATCCTGTCGCATACAGTTCAGCAATGTG
ATGGACTATAAACTTCACATTATTTCTGAGTTTCATATCTTCAATCAAAAGAGAAAGATT
TTAGGTTTGGAACCAATCACTGAAGAGATATTCGAACAAAAGAAAGCTACTGTGGCTTTA
TCTGAGATAAACTCGTAGTAAAGTGATATCTTATTTAAATGTTACCCGTGCAAAAAGTAA
TTCAAGTCCATAGAGCAGCTAGACCAACACAAATTCTCCAAGAATCACAAGAAGAACGAT
AAGATATACCAGCAATAGAATCCACTCGATAATTCACAGAATAATCTTCCTAGTTAGCAG
TCATCGATGTTTCACAATATGTCGAAGGATAACGCACATAGTAAATTCTTGCTTGATCAC
TCACTAGGAGACAAGAATAACTCATCCATTATTGACAATCACGATTCACAAAACAGTGAT
GATAAATTCACTGACCCCACTCAAGAGCATTATGAGCAGCAGGAAAAGCAAAGGAAGTAG
CTGGAGGAAAACGGTGGAAGTGTTGGCACTGATCAGGATGATTCAAGAATACCACAGAGG
ACATCGCTGGAATCGTTGAGAGTGTGCCTGTTTTGCAATCGGGAATTCCCAGGTGTTAAG
AAATGCCTGGATCATATGAGAAATAGCCACAGTTTCTTCATATTGGATATTGATTGCTGC
ATCAACCTAAAAGGCCTGTTGACGTACATAGCAGAGAGAGTTCAACTGGGTTATTTATGC
CTATTCTGCAATAAAATGTTCAAGAATTCCCGCAGATGCCAGCAGCACATGATGGACAAG
TCTCACTGTTTCATGAACCCCACTGATGAGCATGAGTATCAGTCATTCTATGACTTTGGA
AAGCTATACGAGAAGCTCAAAGAAAGTAATGCTGGTACTAATGATGCCACAAGTCAATCA
GAGGAAGTTAAGAATTAGAGCAATCCACTTGTTTAAACACCCACTAAAAGTTCCCAATCA
AAGCCTTAAAAGACCCTAGAGGAAGCCTGGGAGGACATTGACATTGAAGATGCAAATGAA
GATGAACTCTCTCACAAGTCACATGACTTCATCTTGAGCACCCCACAGAAGAGTGTCAAT
GAGGACAGTGACAAATTTTCAATTATTAGCGATTCAGATGGTCAAGCATCGTAAAGTCAA
TAGACAAGCAACCAGGGTGATTTCATTAATGTGGGAACGAACTCCAACGCATCTGAGAAA
TTCAGTTTGATTAACCCACAGTCAAATACTACAATTGTTAACAGATCAGAGAATACCAAT
CAGATATAAACAGGCTAGAGCAACCAGGCTTTTGAGAACTAATCTCAGAAGCAATTTGAT
TGTGTTAGTTCGATTTAGGGACCTACTTAGGAAAAGAAAGGCTTGTCAAGAGCTGAGGCA
TGGTAGAGATTACATATGAGGTAGCCAGAACTATTGGAATCTGGTGAAATCAAATTGCCA
AGTGGAAGAATGTAAGATTATTTACAAAACATTATAATGTATTTTAATAGTATTGGTTCA
AGAGACATGCACTATGTCTACAAGCAGAAGTTCAAGCCTGACGACACCCGTGACTCTGTT
ATTCTGGCAAAATTACAACTAGAATACAGACAGTTAAAGGCACTAACAAATGGAGACATT
CTTAAGAATGATATTCTCGCTAAATAAATTAAGGATCAAGCTAGAGTTAAAGTCAAGCCA
ATGTCCACAGGAATGACTAAAGGACCTGTAGCTAAACTTGGACATTGA


>Contig19988.0.g81(protein)
MLQASNIQNPTASSALSNPYSQNQDKQVICSSCRIQFSNVMDYKLHIISEFHIFNQKRKI
LGLEPITEEIFEQKKATVALSEINSQQSDILFKCYPCKKQFKSIEQLDQHKFSKNHKKND
KIYQQQNPLDNSQNNLPSQQSSMFHNMSKDNAHSKFLLDHSLGDKNNSSIIDNHDSQNSD
DKFTDPTQEHYEQQEKQRKQLEENGGSVGTDQDDSRIPQRTSLESLRVCLFCNREFPGVK
KCLDHMRNSHSFFILDIDCCINLKGLLTYIAERVQLGYLCLFCNKMFKNSRRCQQHMMDK
SHCFMNPTDEHEYQSFYDFGKLYEKLKESNAGTNDATSQSEEVKNQSNPLVQTPTKSSQS
KPQKTLEEAWEDIDIEDANEDELSHKSHDFILSTPQKSVNEDSDKFSIISDSDGQASQSQ
QTSNQGDFINVGTNSNASEKFSLINPQSNTTIVNRSENTNQIQTGQSNQAFENQSQKQFD
CVSSIQGPTQEKKGLSRAEAWQRLHMRQPELLESGEIKLPSGRMQDYLQNIIMYFNSIGS
RDMHYVYKQKFKPDDTRDSVILAKLQLEYRQLKALTNGDILKNDILAKQIKDQARVKVKP
MSTGMTKGPVAKLGH