Identifiers and Description

Gene Model Identifier

Contig8848.0.2.g4

Standard Name

ZNF622a

Aliases

Contig8848_0_2_g4

Description

C2H2 type zinc-finger (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001379203.998395524589391e-34Zinc finger, C2H2 type family
protein
SGDYBR267W1.000116773704384e-19REI1 SGDID:S000000471, Chr II
from 739841-741022, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8848.0.2.g4(coding)
ATGAGATAAATCTTGTTCATTGAAATGTTTTTATCAAAGGATAAGCCACTTTTGGCAGCA
GCAGGAAACACTCAAAATCACAGTTAGATGACTGACAACATGTGGAAATGTGAACCTTGC
AAGAAAACATTCAAGTCCAATGAACAATTACAGCAGCACAAACAAGCCAAGCAACATAAG
AAAAACGAGAAAATCTTCATTGAAAACAACCCAGACACCTCTCAATCATCAATGTTCAAA
TCCTTCTAAGTCGAGAGCAAGAATACTAATTTGATATCAGTTGGAAATTTGTTAACAATG
CTCAAGACTAACGAAAACGAAAATGGGCAGGAAAGTTCACACCCTCCTTCATCTATCGCT
TAATCAATTAACGATCAGGAATCTATTCAGGAAGAGAAGGATGAAGACAAGATACCCATT
GCAACATCACTTGATAACTTGAGAATTTGCTTGTTTTGTAACAAGGAAAGCGAAGGCATT
AAGAAAAATCTCGATCATATGATGCTTGCACATTCATTCTTTGTTCCAGACGTTGACTGC
ATTATTAATCTTAAAGGATTACTTGGATATATTGCTGAAAGGGTACATTTAGGTTTCCTC
TGTCTGTACTGTAGCAAACAATTCACAAATGGCAGAAGTTGCCAACAGCACATGATGGAT
AAGGGACATTGTTTCTTAAATCAGGATGATGAAGAGGAATTTGAAGAGTTCTATGATTTC
AGTAAAACCTACGAAAACCATCCATTGGCTATCAAAACAACAAAAAGAGTAAGGAAAGAA
GGAGAAGACGGCGTTGAAGATGGAAAGGGAGAAGAAGCCTGGGAAGATGTTGATTTCGAG
AGTGCAGATGAAGAAGAAGTAGTCGAAGTTGATGAAGAAGAAAAGAAGGAAGATGCCACC
ACTGCATTGAAGACAGATGACTCTGAGTAGATTGATACCACTACAAAAACAGAAGATGGC
AAGACTGAGGAGAAAGCAGGCAAGCAATTCAAGCAGAAATTGGGTAAAACAAGAGAAGAA
GCACTTCTCGGCTTGAACATTAAACCAGCTGAGCAACTTGAAACTGGCGAACTAAAACTT
GGCAGTGGAAGAATTATCGGAACAAGGGAACTAAAGTACATTTATAAGCAGAAATTCAGA
ATGCCAGATAACAGAGAAGCTGTATTGATTAATAAACTCGCAATGGAATATAGAAAGATC
AGGTCTATTGCCATCGAAGGCACTACCTCTCAGATTAATCATCATGCTGCTTTACAAGTA
TACAATGGCATGACAAGATAAAACAAAATGGATCTGGATCACGTTAAAGCGTTCACTAGA
AAGAGCAAGAGAGAAAACTACATGACATTGAAAATGGGTCTCACAGGAAACAACCTCCAA
TATTATTTCAGAAAGAGAGAATGA


>Contig8848.0.2.g4(protein)
MRQILFIEMFLSKDKPLLAAAGNTQNHSQMTDNMWKCEPCKKTFKSNEQLQQHKQAKQHK
KNEKIFIENNPDTSQSSMFKSFQVESKNTNLISVGNLLTMLKTNENENGQESSHPPSSIA
QSINDQESIQEEKDEDKIPIATSLDNLRICLFCNKESEGIKKNLDHMMLAHSFFVPDVDC
IINLKGLLGYIAERVHLGFLCLYCSKQFTNGRSCQQHMMDKGHCFLNQDDEEEFEEFYDF
SKTYENHPLAIKTTKRVRKEGEDGVEDGKGEEAWEDVDFESADEEEVVEVDEEEKKEDAT
TALKTDDSEQIDTTTKTEDGKTEEKAGKQFKQKLGKTREEALLGLNIKPAEQLETGELKL
GSGRIIGTRELKYIYKQKFRMPDNREAVLINKLAMEYRKIRSIAIEGTTSQINHHAALQV
YNGMTRQNKMDLDHVKAFTRKSKRENYMTLKMGLTGNNLQYYFRKRE