Identifiers and Description

Gene Model Identifier

Contig10059.0.0.g15

Standard Name

ZNF580

Aliases

Contig10059_0_0_g15

Description

C2H2-type zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004630300.000000000008998169033602767Zinc finger, C2H2 type family
protein
SGDYPR186C0.00000000009998509410508463PZF1 SGDID:S000006390, Chr XVI
from 911022-909733, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10059.0.0.g15(coding)
ATGTCTCAAGGGAAATATTTCTGTGAATAATGCAATATTGCTTTTTAAAAGCCAAGTAAA
CTCAAGAGACACATTGCTAATGTTCATGAAGAAGTGAGACCTTATAAATGCGAAGATTGT
GGATAAACCTATAAAAGAAAAGAGCATCTGACTAGACACTAGAGCTCAGTTCATAACGAT
AACAGGGAAATTGAGTGCCCATATAAAGATAGCGAGGGCTGTCTATTAAAGTTCCCTAAT
AGAGACTAATAGAGAAAGCATATTCAGAGGAAGCATGAAAAAAGATTGTTTTGTGATATA
TGCTTCATGAAACAATTTGAGGACTAAAATGATTACTAAGAGGGTTTAAATCTCCTCAAT
ATAATAAAAAGTACTGAGATATAAGAAGACTCGTAACTAGACCTCTCTTATAATGGTTCG
CAGTACATTCAAGAATTTTAAGTTCCAATTGAACCTGCACAACTCAATAATCAAACTCAA
AAGTTAAATAATACACCCCAAAAGTCCAAGTCATCAATGTCATAATTCAATAAGCTTAAG
ATCTTCAAACACCCTGCATATTTTTAAAAGAAATCTCAACTGAAGAAACATATGACAGAA
TAGCATGGGGAGGGCTATGAATGTGTGGATCACTGCGGCAAGAAGTTTGCTAAGAAAAAA
TTGCTAAATGCACATTTAGCAAGGGTTAAGTAGTAGATGAAGAAGAAAAATGCTCAAATA
TATAATTACAAAGATGATGAATCAGTGTATGAAGTTCGCCTAAAAGCCCAAAAAAGTAAT
GCCACTACTTACACAAACAATCGTAATAATCTTGATTAAGAAGAAGAAAAAAAGGAATAA
TTTTCTCGTTAGATGTCAAACTACCAAGATGAATAAGATTCATAAAACCCTTATCATAAT
GAAACTGAAAACGATTTCTCAAATAGCATGTAGCTGTACAATTTGAATAAAAGACGTCGA
TTGGATGAACATGGCAATGATTTGCTTATTGATAGAGTTGGTTAGGAATCTTAGAGTGAA
TGTTCAAATATTAAAGATACCCTCAGGTAGAATAGCAATTTAAGTGGAATGGATGAAAGT
CAATCTATAACAGCCGCTCTTTTGGCATTCGATGAGTAAAAAAGTGTTTTCAGTGTAGGG
GATTTCTTGAATTTGAATGGCATGATGCGAAGAGATAGCTTAAATAGTCGTTTAGAATTG
CATTCTCCACGTTTAAACAGACAATTAATGGTTTGTATGAATTGTGGTAAAATTCAAGGT
TCAAGCTAATAAACCAAAAATTTCATGAGACATCTTGGCAAATGTAAAAAACGTAAACCA
GAAGAGATTGAAGCTAAACGGTAGGGTAGCAAGAAATTAAAGTTAAAGGAACTATTTCTT
AATAAAGATGAAATGGAATTAATTAGACCTAGTAGTCTAATACAGAGTAAGGAGTGA


>Contig10059.0.0.g15(protein)
MSQGKYFCEQCNIAFQKPSKLKRHIANVHEEVRPYKCEDCGQTYKRKEHLTRHQSSVHND
NREIECPYKDSEGCLLKFPNRDQQRKHIQRKHEKRLFCDICFMKQFEDQNDYQEGLNLLN
IIKSTEIQEDSQLDLSYNGSQYIQEFQVPIEPAQLNNQTQKLNNTPQKSKSSMSQFNKLK
IFKHPAYFQKKSQLKKHMTEQHGEGYECVDHCGKKFAKKKLLNAHLARVKQQMKKKNAQI
YNYKDDESVYEVRLKAQKSNATTYTNNRNNLDQEEEKKEQFSRQMSNYQDEQDSQNPYHN
ETENDFSNSMQLYNLNKRRRLDEHGNDLLIDRVGQESQSECSNIKDTLRQNSNLSGMDES
QSITAALLAFDEQKSVFSVGDFLNLNGMMRRDSLNSRLELHSPRLNRQLMVCMNCGKIQG
SSQQTKNFMRHLGKCKKRKPEEIEAKRQGSKKLKLKELFLNKDEMELIRPSSLIQSKE