Identifiers and Description

Gene Model Identifier

Contig19139.0.g77

Standard Name

ZNF1u

Aliases

Contig19139_0_g77

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR113W2.0004286606204839e-16AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...
T. thermophilaTTHERM_002392600.00000000000040012475857291343Zinc finger, C2H2 type family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19139.0.g77(coding)
ATGTCTAAGATATAATCAACTTAAAAAGATGTCCAAAAATCCTTCAGTTGCAATTATGAA
GGGTGCGAAGCAAGCTACACACGATCATACAGATTAAACTTTCACATTAAGAGTATGCAT
CAGGGTACCGAAAGCCGCTACGAGTGCGATAAATGTAACAAAACTTTCTCAGAAAAAGGT
AATATGATTATTCATTAACGCCAACACACCGGAGAGAAGCCTTATAAATGCAAGGTATGC
CACAAATCATTCACTGCGAATGGGAACATGAGAGATCATGAGAGAAGGCACTTGAAACAA
AAACCTTATCAATGCGGTTGCTGCGAGAAGCAATTCTATAGGAAATATTTGCTTGAGTGA


>Contig19139.0.g77(protein)
MSKIQSTQKDVQKSFSCNYEGCEASYTRSYRLNFHIKSMHQGTESRYECDKCNKTFSEKG
NMIIHQRQHTGEKPYKCKVCHKSFTANGNMRDHERRHLKQKPYQCGCCEKQFYRKYLLE