Identifiers and Description

Gene Model Identifier

Contig2290.0.g31

Standard Name

ZNF1p

Aliases

Contig2290_0_g31

Description

Zinc finger, C2H2 type

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00096 ) Zinc finger, C2H2 type
  • ( pfam13465 ) Zinc-finger double domain
  • ( pfam12874 ) Zinc-finger of C2H2 type
  • ( pfam13894 ) C2H2-type zinc finger
  • ( pfam12171 ) Zinc-finger double-stranded RNA-binding
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)
  • ( pfam08790 ) LYAR-type C2HC zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002955609.995317835403734e-19Zinc finger, C2H2 type family
protein
SGDYOR113W2.000769134519826e-18AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2290.0.g31(coding)
ATGGTCAACGTCACTAATGAAAAAAACATCGACCCAAATATCATGCCATATAATTTATTG
CTAGAAAAAATTGCTACCAATAACAACATTGATAATAAAGTACGTTAACACTAAATGAAC
ATTTAGCAGCAACTTAGTTTATAATAAAATAACTTCCCTGAGAATTATGATATATAAAGC
CAAGGAGGGGCGGGTAGTCGCTTCCTTTGCACATATCCTGATTGTGGAAAAAGTTTTTCC
AGAAAAAGTAGATTAAAAGCCCATCTTCATTTGCATTGGGGTACTCAACCTTTTAGATGC
GAATACCCAGGATGTACCAAGGCCTTCTCGGAAAGACCCAATCTAATCATTCACAATCGA
ATACACACAAAGGAAAAGCCTTTTTCTTGCAAAATGTGTGGGAAAAAGTTCACAACTAAG
GGTAACATGAAAGATCATGAAAGAAGACACTTTAAGCAAAAGTATGAAAAACCTTACTCA
TGCGAAACATGCGGATTCACTTTCTACAGAAAAAACATCCTGAATAAGCATGAACAAAAT
TGCAAAATTTCAGATGAAGAGCAGCAGTTCTTGATTAATAATGAATTTATGAACGACTAA
CTTGGCCTGTGCTTTAGTAATCTCAGTAATCCAATGCATTCTTAATAGATTATTGCTCTA
AATAATCAGAAATGCATCTAAGATTAGTCAGGTATAGAGATAAATTCTCTATAGACTATT
AATCCCTAATTGTCAACACCACAGCTTTTGATTGACTAGAACCCACTTTCAAGCCTTTAA
GCAGTCTAAAACCCTCATTAGATTACAAACCAATAAAGTTAACTTCGAGAGTACAAAGTT
TAATCGATAGGACCTACTCCTAATTTGATTCAACCTTAAGGTATTATGCAATCTACTGGC
TAAACCCTCTAAAATTAGGGAGGTGGAGTCTCCTTCGCTTCATAGCCTATCCAATAATCA
CTTCACTAAAATATAGCTAGCAGTGGCAATCACTTATAGTCATATTAAGGAAATCAGCAA
ATGAATCCAACTATCTAGGCGCCAAACTAAATATTGTATTACAATAATATTAGCAATCAG
CAAAATGGGCAGTAATATAACACTCCAAGTCAGATGATTTTCAACTCACAGCCGATGTAA
TGCTTTCCATCGAACGGAATGCTTTAGTACTAAATGCTAGCATAGCCGCATTGTGGAGGA
AATTAAACTCAGCTTTCTTAGTCTTAAGTTATAAGTTCACTACCGTAAAGTTAACTTTTT
GTCAGCTAAGCCCCACTTCAATAAAGAATTCTGCCAAATAACTATGCTAACTCTCAACAA
CTACCCTACTACTCAGGTTACCCGATCCAAAGCCTGATCTCCCCATATAGTAGGCAAGTT
CCCTAATCCCAATACAAAGGATAATTCTAATAGTAGCCACTCTTTCAATAAGTTATGACA
TCAAATGGAAACCAGATAACAGTGCCAGTTTAGCCCATTCAGCAAAACCAACACCTCAAT
CAAAAGTGTTTTTAACCAAATATAACAACAATATAGCCCTAGACTAGTCTTTACAACAAG
CAATACCCTCAAGTAATATTCTAATAAAATTTCAACTAATAAGCAAATATGTAATAATCT
GACCAGCCTTACTAATCTAATAATAACATCTAAATGAACAGTTATGTTCAAAACAATAAT
ACTAATAACTATTAATGA


>Contig2290.0.g31(protein)
MVNVTNEKNIDPNIMPYNLLLEKIATNNNIDNKVRQHQMNIQQQLSLQQNNFPENYDIQS
QGGAGSRFLCTYPDCGKSFSRKSRLKAHLHLHWGTQPFRCEYPGCTKAFSERPNLIIHNR
IHTKEKPFSCKMCGKKFTTKGNMKDHERRHFKQKYEKPYSCETCGFTFYRKNILNKHEQN
CKISDEEQQFLINNEFMNDQLGLCFSNLSNPMHSQQIIALNNQKCIQDQSGIEINSLQTI
NPQLSTPQLLIDQNPLSSLQAVQNPHQITNQQSQLREYKVQSIGPTPNLIQPQGIMQSTG
QTLQNQGGGVSFASQPIQQSLHQNIASSGNHLQSYQGNQQMNPTIQAPNQILYYNNISNQ
QNGQQYNTPSQMIFNSQPMQCFPSNGMLQYQMLAQPHCGGNQTQLSQSQVISSLPQSQLF
VSQAPLQQRILPNNYANSQQLPYYSGYPIQSLISPYSRQVPQSQYKGQFQQQPLFQQVMT
SNGNQITVPVQPIQQNQHLNQKCFQPNITTIQPQTSLYNKQYPQVIFQQNFNQQANMQQS
DQPYQSNNNIQMNSYVQNNNTNNYQ