Identifiers and Description

Gene Model Identifier

Contig22141.0.g41

Standard Name

ZNF1m

Aliases

Contig22141_0_g41

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13465 ) Zinc-finger double domain
  • ( pfam00096 ) Zinc finger, C2H2 type
  • ( pfam13894 ) C2H2-type zinc finger
  • ( pfam12171 ) Zinc-finger double-stranded RNA-binding
  • ( pfam12756 ) C2H2 type zinc-finger (2 copies)
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)
  • ( pfam02176 ) TRAF-type zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR113W1.999598840915195e-17AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...
T. thermophilaTTHERM_002955600.000000000000001999258566166494Zinc finger, C2H2 type family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22141.0.g41(coding)
ATGCCAAAGAATATCAATCCTCGAGACTCAAAGAAGTTTAAATGCCATTACGAAGGATGT
GAAAATGCTTATACAAGAGTCTTTAGACTAAACTTTCACATTAAAACTTTCCATAGAAAA
ATTAAGTAGACGTTTCCCTGTCTACAATGCGGTAAAACATTCTCAGAAAGAGGTAACATG
AGAATTCACATGCGTAAACATACAGGGTTCAAGCCCTTCGCTTGCGAGTTCTGTTCAATG
AGGTTCTTCTCTAGTGGAAACATGAAAGATCATCAAAGAAGGCACTTATCAGACAGGCCG
TTTGAATGCAATCACTGTACCAAGAAATTCTACAGGTAGTATTTGCTCACAAGTCATGCA
CAGAAATTTCATCCTCAGGAATACAAAGAGAACAAATATTAATTTATAATAAACAACAGG
CAAAATATTAGCCCAGTTCAAAGTGTAGCAATTGTCACTTCACCATAAGTCTTTCCAATC
TAGAATATTATAGACAATAGCTTGGTCTATTAAAATCCTTAATTCATGTATTAACAAAAC
TTGCAAAGAGAAATGTAGAACTGTAATTAAATCCCTAATCACTTAAACATACAACCTTTG
CCCACAATTGCAAGTTGCTTAAATTTATAGTAAAGCTATAATTCACCACCAGTATAAACT
ATTTATAATCAGCCAGTTAATCACAGAATATAGAAAATAGCAGAGGAGTCATCCTAGTTT
TGCAATTGCCCCCAGTCTGTCAATCTATTCCAGAATAACAACTAGTCCTTCATTTTTAAT
TAAACATCCCAGTCTGCATAGCCATAAAATACATTCTAAACTTAGCCTTCATTATCCAAT
TATGTTATCTCGCAGATTCCAAATCAATTCTAGACAGGCTTTCAAAACATGACTAATTAG
TCATATCAATGTGGAAATAATTTAAGAACTGAAGAACATTTAAATTAAAATTGGAATGGC
AAATTCAATAATGTGTAAATGAATGCACCTAGAGATTTCATCATTGTCAGTAATCCGAAA
GAAATATATCAAAACTAAATCCCAATTATTCACTCTCAATAATCAGATAGGCAAAGATAG
GTTCATGAATTTGCTTAAAACTTTCTTATCCATGAATCCCACCCCAACCCAATTTAGCAT
AGTTTGGGCATTTAAAATCCGTAATTTTATCAAAACTAGCAATAATTGAATAAACCTCTT
AACCAACACGATTTTTTGAGGTTAAGTAATGACTATTTATAAAAACAAATGAATTCACAC
TAATTCATATGA


>Contig22141.0.g41(protein)
MPKNINPRDSKKFKCHYEGCENAYTRVFRLNFHIKTFHRKIKQTFPCLQCGKTFSERGNM
RIHMRKHTGFKPFACEFCSMRFFSSGNMKDHQRRHLSDRPFECNHCTKKFYRQYLLTSHA
QKFHPQEYKENKYQFIINNRQNISPVQSVAIVTSPQVFPIQNIIDNSLVYQNPQFMYQQN
LQREMQNCNQIPNHLNIQPLPTIASCLNLQQSYNSPPVQTIYNQPVNHRIQKIAEESSQF
CNCPQSVNLFQNNNQSFIFNQTSQSAQPQNTFQTQPSLSNYVISQIPNQFQTGFQNMTNQ
SYQCGNNLRTEEHLNQNWNGKFNNVQMNAPRDFIIVSNPKEIYQNQIPIIHSQQSDRQRQ
VHEFAQNFLIHESHPNPIQHSLGIQNPQFYQNQQQLNKPLNQHDFLRLSNDYLQKQMNSH
QFI