Identifiers and Description

Gene Model Identifier

Contig622.1.g111

Standard Name

ZNF1l

Aliases

Contig622_1_g111

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR113W0.00000000002000577768187062AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig622.1.g111(coding)
ATGCCCTATTGGTATCCCTCTATATATATTTATATCAAATAGGAGATATTTAAGATTAGT
AATTTAATCAGACATGAAAGGATTCACACAGGAGAGAAGCCTTATATTTGCAATATTTGC
AAGAAAAAATTCGCATCTGGTTCCAACTTAAAATAGCATGTTCAAGTCCATGATAATGAT
GAAACTCGAGTTCAGTATAAATGCTATGTAGCCGACTGTGGGAAAGGCTATCTCTACATA
AGCTCCCTAAAAAAGCATATTCAAGTTTCACATCCGAACGAATATGAAAATGACATTAAA
ACCAATAAAGTTGATTTGAATGACTGTAAAGAAATTATATAAGATCTTATTAATCACTAA
TATCATGATGATGAAGAGGAAAAAAGTGAGTAGACTTACCATAAAATTGAGAATACCTAA
CCTGACCCGGAAAGCCACTCTTAACAAACCAAATAGGGACATATCGTAATGCTTGGCAAG
AGGAAGTACCAAGATGAACATGGACACATACAGTAGATTCCTCAGAGGAGAAAAATAAGA
ACAAACTAGCCCACTTAATCTCCTTCTCAAGAGGAAGTGGAACAAAGTATTGGAGCTTTG
ATTTCTAATAAGATAAAAAAGCACCCCAAACATATAAACATCCAGAGTTAATTTGCCTCA
TAGAATCCCTAGTTATTCACTAATCAAGAGGAGCTCTCTCATAAAAGAAATCTTCACTCG
CAAAACGATCACATTAGCACTTCTAAGCAAACTAAGCCATAGAAGTACGAACAATTACCC
TCTGATTAACAATAGGCAAGAGAACCTATGATAGTCAAGAAAGAATCAGAGCATCATCAT
CATCACTACACAAACCTCTAATCCCCTTCTAATAATTATGTTCAAACTGACTATGCTAAA
AATCTTCCCACTATGTAAAGACAGCAGTCTGTGGAGAATAGATCAATAAATGGCCAATAA
AATCAAGAATAGGCATAGATAAGAGCAATTAAAAAGCCAATAATTCAAATTCAAAACAAC
CTATAGTAGCAAAATTAAGTTTCAAATAATGTACAATCCATCCAAAATTAGATGAGTTCA
GCGAATTCTTCCTTAGATCTCGCTCAAATAAAGCAGAATTTGATGATGCCCCAGGTAGTT
CTAAATTCATAACAACTATAGCAGGATAATAATAGCAGCATTAATAAAATGCCTTATCAA
TTGATCATGGGGTAACAATCTTCATAAAATCAGATACCCCTAAATCCTCACTTCGTAAAT
AAAAGAATTACACCAGATTTATTACTAGCCTCAGTCAGTCCCATACAGAAATCGTTAATG
AAAAATAATAAAGGTAACGCTGGAGAAAACGGGTCTTAAATCATATCACCAACCATACAG
CAAGCTTTTCAACCATTCAACTAAAATCAATATTAACAATTTCAAACGCAACAGATCTAG
CAGCAATAACCACCAAGCTATGAGTATCTATACCAGCAGTAAACACCTTAAGGTTTCGTC
CAACCTTAATCTCAGCAGTTGTAATATTAGCAGTAGCAATAGTAGCCCCAATACACCTCA
TAGCAGCTTGACTTCTTGCCTACCACTTAGGCCTAATAAAGTGAGAAGTATCATCACTCT
CCATCATAAGAGGAAATTAATCAATAATAATAGTAGCAGAATAAGTTAAAGTAATAGTAA
TAACAATAATAGAATATGCTCAGGCAATAAAAGGAGCAGTAGGATCTACAGAATGCACTT
ATCTAGTAACAACAGCTTTAAAATCAGCAGCAATAGAATCTCTAAAGCATGAATACAGCT
ACTTAAAATTAATAATCACAGAATTATGATAATTATTCTACCAGGATTGTCAGCTCTGAT
TAAATCCCAACCTAAGAACTGAAATAGTAGCAACAAAAGTAAGATTTACTATAATAGGAA
ACTTAAGAAATAATTAACTAAAATTAATTAGCAGAGTAATAAAATTAGAAATAATTAGTG
TAAGCTCAAATTTAAAATAAAAAAGCGGCTGATTAAGAAGAAAATAAAGTAAATAAGACA
TCAGAAGAAGAAGTGAAACCTTTGCCATAAGTTCAGAAATCTAATTCTACTGCACCTAAG
TCTATTGATTAATAATCTCATCTTTTCAACGAAATGCAAAATTTACAGACTAAGTTAGAA
GGAGCAGATCCTTTGTTTTTGGCAGCATTTCACAATCTTTTGAACGATTTGACTGTTAAA
GTAGCTGGTTTATCAGAACTTTTTTCTGCAAAAACTCTGCAAGGTTAACTTCAAACTTAG
ACAAATTCAGAAGACAACACATAGAATATCGTTGTTAGTTCTATTAACAACAATGAGCAA
TAATAAATGAATTAAAGCAAAAATAATTTATATTCAAAGTCTCCAAACAAATTCCAAGCA
GATGGCTTGAAATAAATTAGCATCCCTAATAGTTTGAATATTGAGAAAGACAATTCCTTG
GCTTTAATGAACTTAGGGGATGGAGGTTAAGACAGTATGTTTAATAAAACAAATATATCT
ATTGATGCAATGTAAGTCGAGAACTCCAAGTAATTAATTAAACCCGAAGAAAATACAATC
TCCTCAAACGCTTCAGTTATATCGCAAGGGAACGATTCACTTAATTCTTCACATGCTAAG
AGATTCAAGTATTAGAGTTAGCCACTTAAAATCAATAAATAAGGTGGAAGTGGTAAAGTT
CATTTGCAGTAAGAGGTCTGCAAGCCCAGCTAATTTAAACTATAGACTTAAGCTTCTTAA
GATGAATTGGCAACCATCGAGAGATCAGACTCATTCATAAAATCAAATGAAAACAAAAAC
ATCAAAGATCTATTCGAAAGCCAAAATAAGGATAATGATGCAATTCAAAAATCCTAAGAA
TGGTTCTTCAATGAAAGCGCAATGCCAAATGCAATTAATTAATATGAAGACACCTCTGTA
ACTTAAAGACAGGGCGGAGGCGGCTGCAGATCTGAGCAGAGAGACCCTTCAAGTAATGGA
GGAGGTGGTTGCGGTGGTTCGTGTTCAGGAGGTGGAAATTAATAACAAAACCCTGATTTA
AGTCAAGATCAACAGAAATACTATCAGAAAGCTCAACAATTGCTAATGAAAGCCAAGCAA
AATATGAGACAATAAGAAGACAGTGGTTGCTGTTCTGGTTCAAAACAAGCTTCTTCATGC
GCTTGCTCAGGTGGAACAAATACTCAAGACTAGGACTAATTATAACACCAAAATCAGTCT
ATGGGGGGCTGTGGTGGATCTGTAGCTAGAGCTAGGTCTATGCTTGACGATGACGAGGAA
GCCATGATGGTTGAGGAGATGAATAGAAATGGCCCAGATGCTGAAAACTTCAAAGCACCC
TTACCAATCGGTCATAGGAGTAACGCTTCAACTGGACAACCAAATAAAAACAGAGATTCT
ACTCTACTTTTATTCTCAAAATTACCATGCATCAAGACCTGCCTCACAAAAGTTAACTTT
GGTGGAAGCAATGATAAAGTCCAGTTAAAGAGCGATATTTGCAAAAATAACAAAGGAATT
GGCTTTGAAAGCTTAGATGACGATTTTGATATTTAAAGCACCAGTTAATTAGGTACAGCC
GCTTGTAAGCATATATGTGATGCCCAAAAACTTTGCCCAGAGTTACTCCCCGCAAATTGT
GATGATTATTTTAACAAGAAATGCAACTGCACAGTATATTGCAAAAAGACACTCAAGTTC
ATCTAGAAGTTTGTTAAAGATGACACTTAAGTTGCAGAAATAGAGGATTTATGTAACATT
TAAGATTAGATTTCTCTGATGGTAAGCTAAAACGGTTAGAGATAGTGA


>Contig622.1.g111(protein)
MPYWYPSIYIYIKQEIFKISNLIRHERIHTGEKPYICNICKKKFASGSNLKQHVQVHDND
ETRVQYKCYVADCGKGYLYISSLKKHIQVSHPNEYENDIKTNKVDLNDCKEIIQDLINHQ
YHDDEEEKSEQTYHKIENTQPDPESHSQQTKQGHIVMLGKRKYQDEHGHIQQIPQRRKIR
TNQPTQSPSQEEVEQSIGALISNKIKKHPKHINIQSQFASQNPQLFTNQEELSHKRNLHS
QNDHISTSKQTKPQKYEQLPSDQQQAREPMIVKKESEHHHHHYTNLQSPSNNYVQTDYAK
NLPTMQRQQSVENRSINGQQNQEQAQIRAIKKPIIQIQNNLQQQNQVSNNVQSIQNQMSS
ANSSLDLAQIKQNLMMPQVVLNSQQLQQDNNSSINKMPYQLIMGQQSSQNQIPLNPHFVN
KRITPDLLLASVSPIQKSLMKNNKGNAGENGSQIISPTIQQAFQPFNQNQYQQFQTQQIQ
QQQPPSYEYLYQQQTPQGFVQPQSQQLQYQQQQQQPQYTSQQLDFLPTTQAQQSEKYHHS
PSQEEINQQQQQQNKLKQQQQQQQNMLRQQKEQQDLQNALIQQQQLQNQQQQNLQSMNTA
TQNQQSQNYDNYSTRIVSSDQIPTQELKQQQQKQDLLQQETQEIINQNQLAEQQNQKQLV
QAQIQNKKAADQEENKVNKTSEEEVKPLPQVQKSNSTAPKSIDQQSHLFNEMQNLQTKLE
GADPLFLAAFHNLLNDLTVKVAGLSELFSAKTLQGQLQTQTNSEDNTQNIVVSSINNNEQ
QQMNQSKNNLYSKSPNKFQADGLKQISIPNSLNIEKDNSLALMNLGDGGQDSMFNKTNIS
IDAMQVENSKQLIKPEENTISSNASVISQGNDSLNSSHAKRFKYQSQPLKINKQGGSGKV
HLQQEVCKPSQFKLQTQASQDELATIERSDSFIKSNENKNIKDLFESQNKDNDAIQKSQE
WFFNESAMPNAINQYEDTSVTQRQGGGGCRSEQRDPSSNGGGGCGGSCSGGGNQQQNPDL
SQDQQKYYQKAQQLLMKAKQNMRQQEDSGCCSGSKQASSCACSGGTNTQDQDQLQHQNQS
MGGCGGSVARARSMLDDDEEAMMVEEMNRNGPDAENFKAPLPIGHRSNASTGQPNKNRDS
TLLLFSKLPCIKTCLTKVNFGGSNDKVQLKSDICKNNKGIGFESLDDDFDIQSTSQLGTA
ACKHICDAQKLCPELLPANCDDYFNKKCNCTVYCKKTLKFIQKFVKDDTQVAEIEDLCNI
QDQISLMVSQNGQRQ