Identifiers and Description

Gene Model Identifier

Contig1194.1.g73

Standard Name

ZNF1f

Aliases

Contig1194_1_g73

Description

Zinc finger, C2H2 type

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002392602.0002795641672355e-21Zinc finger, C2H2 type family
protein
SGDYPR186C6.002144168983342e-19PZF1 SGDID:S000006390, Chr XVI
from 911022-909733, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1194.1.g73(coding)
ATGGAATTTAGGATTGAACTTTTCCTGGAATCTAATATGACCCCCTTAAATATAATATCA
CTATGTGACCAAGTCCTCAATAATAATTCGCAAGAGTAACTTAAAAAGTATAATAATCAA
AAATGCGTTATAACTCTGATAAATCCGCACTTCTCCGAGATGAATCAAAACCAGCAGCAC
TAGATAGGACCTGATAAGTACCGCAACCCCGACTCCTTCCAAGATATCAAGCAGCTAATT
GATAATAATTAAGAAGATATCATTCACGATAATGTTTCAAATAAAAAATATAAATGTTTT
TTCGATAAGTGCCGCAAAAGCTATTTTACGGTCTAGTTACTAATTTCTCATCAAAAAATT
CATCAATCAAAAAGACCATTCCCTTGTACTTATGATGACTGTGATAAAGCATTTATGACG
AAAGGTCACTTAAATAATCATTTAGAAACACATTTAGAAAATAAATAATACTCCTGCTCG
TTTGAAGGGTGTAACAAATCTTACAGTCGCTTGCAAAGACTCGATGTGCACTAAAAGACG
CATCTTGGCTAAAAAGAGTATGTCTGCCCCTACAAAGAGTGCCAACGTGCGTTCTATGAG
AAGGGTAACTTGAAAACACATTTACGCATCCACACAGGAGAGAAGCCGTATCATTGCTAC
ATTCCCTGGTGCTTGAAATCCTTTTCAACTCAAGGCCATCTAAATGATCACATCAAAAAA
CATTAGGAAGGAAGAATTAGGCCTCCTCATAATTACAATAGTGCCAATGTTAGCTAGCAA
GACGCAATGTCTCTAATGAGATTTTAAGAAAGAGACTAAGATAATGATTCTGACGAAGAA
ATTAAGGAACCTGATTCTAGTAGAGAGGAAACTCATCATAAAACAGCTTCAAGATTGGAT
TTAGGCGCATTAAATTAAACTCATCATAACAGTGCTGGAGCAGGAGGAAATCTTAGGAAA
ACACTAGGCCATTAGGCTGAAAACAAAATTACTAATTTTACAATCAATAGCGTCAACACA
TCTAGTTAAATGCCAATAAGCACATTTTCCATAGAAAATAGAGAGGTAGATGAAAATCCT
GTTTATCTTGGAAATTTGATAAGATTGGGTGAATAAAAACGGGGTCCTAGATCCATGAGA
TGTAATAATGATGTTGAAGAACTTAGTAAAACAAGTCCCTTAAAAAGACTTAAAATTCAG
ATGACAGAGATTGAGAGTAATTCAGATATTAATAGTGGGTGCGTACCTATTCAAGGAAAC
ATCAAAAATAATAATGATCTATCTTACTCATCGTAGCAAACGACTGAGAGTCAAAAGAAT
TCAAACAAAGGTAGTTTGAGTAAGAGGAAAATCATTTTACAAAATTTGAATTTAAATGAT
ATTATCAACAAAACTAAGTAATCTGATGAAGGGATTAAACTGGAAAAAGATGAAGATGGG
TTCGATAGACCAACTCCTCTAATAATAAAATCAGTCAGTGTATCGCCCAATAAAATAGGC
GGTATGCTTAAACCAACCCCATTAAATTCTTTTCTGAACGCGTTATCCCCAAATACCTCG
TCGCTATAATTATTATAAGCAAATGCCGCACTTTATGCAAATCAATAACTTTAAAATGCT
GCAGCTCAGATTTACTCAAGCTACTCCCCCTAACCTCTTAGTAGCCTATAGTAGCAATAA
GCTGCTTTCAATTAATTGTAGATGAATTTAGCTGCTCAATAATAACTACAGTAACAGATG
TAACATACACCATCTTAAATGGGATCTTAGCAGTAAGCTTTTTAAAACATGCTAAGTGGT
ATGACTCCTAATTAATTCCTGATGAGCTCTCAAAATTAGTTCCTTTAGCCCAACTCCCTT
GCCCTGAGTCGAGCTCATCTAGCTGGAGGCTAGTCTTCCTAGACTCCCCTGACTTATAAT
TCAGCCTTCTAGAACAAAAATCTAAATGGATTGGGATAATTAGGAATGAACGGGCCAGGA
ACTGCAAACAGCTAAAGTTAAGCTTCTCCAAAAGTTTTCACTTGGAAAACCGACCACATC
TAAATGCTAAATAACCCAGAATCAACTACTTCAGCACTCATCTAGCAGAGTGGGTCGACA
GCCGCTTTGATATAGCAGTAGTAATAGTAATAGCAGCAACAATAAGCTGCTCAATAATAA
GCCTAATAGTAGAATCTTTCAAATTAATATCAAGGTTTGATGCCATCACCCGCCCTAAAT
TTAAGTCATTAAGCTTTCTTCCCAAGCCCCAGCCCTATGATGCAAAACTAAAACCTAAAT
CAAAATCACAACTCTAACCTATCAGTGTCAAGAATGGGACAACAGTAAAATAATTAAAAT
TAAAACATGGGTTACAGCTCATTCAACGCTTTATAATTTACGCCATTATCAAGCTCATCT
TCAATTAATCACTTCAACTTCATGCCCACATCAAGCAATAATCAGTAAGATACAGCAAAC
AACAGACTCTAATGA


>Contig1194.1.g73(protein)
MEFRIELFLESNMTPLNIISLCDQVLNNNSQEQLKKYNNQKCVITLINPHFSEMNQNQQH
QIGPDKYRNPDSFQDIKQLIDNNQEDIIHDNVSNKKYKCFFDKCRKSYFTVQLLISHQKI
HQSKRPFPCTYDDCDKAFMTKGHLNNHLETHLENKQYSCSFEGCNKSYSRLQRLDVHQKT
HLGQKEYVCPYKECQRAFYEKGNLKTHLRIHTGEKPYHCYIPWCLKSFSTQGHLNDHIKK
HQEGRIRPPHNYNSANVSQQDAMSLMRFQERDQDNDSDEEIKEPDSSREETHHKTASRLD
LGALNQTHHNSAGAGGNLRKTLGHQAENKITNFTINSVNTSSQMPISTFSIENREVDENP
VYLGNLIRLGEQKRGPRSMRCNNDVEELSKTSPLKRLKIQMTEIESNSDINSGCVPIQGN
IKNNNDLSYSSQQTTESQKNSNKGSLSKRKIILQNLNLNDIINKTKQSDEGIKLEKDEDG
FDRPTPLIIKSVSVSPNKIGGMLKPTPLNSFLNALSPNTSSLQLLQANAALYANQQLQNA
AAQIYSSYSPQPLSSLQQQQAAFNQLQMNLAAQQQLQQQMQHTPSQMGSQQQAFQNMLSG
MTPNQFLMSSQNQFLQPNSLALSRAHLAGGQSSQTPLTYNSAFQNKNLNGLGQLGMNGPG
TANSQSQASPKVFTWKTDHIQMLNNPESTTSALIQQSGSTAALIQQQQQQQQQQQAAQQQ
AQQQNLSNQYQGLMPSPALNLSHQAFFPSPSPMMQNQNLNQNHNSNLSVSRMGQQQNNQN
QNMGYSSFNALQFTPLSSSSSINHFNFMPTSSNNQQDTANNRLQ