Identifiers and Description

Gene Model Identifier

Contig581.1.g61

Standard Name

ZNF1d

Aliases

Contig581_1_g61

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002955603.998693556225637e-29Zinc finger, C2H2 type family
protein
SGDYJL056C2.000470901975128e-28ZAP1 SGDID:S000003592, Chr X f
rom 333073-330431, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig581.1.g61(coding)
ATGACCAACGTCGTTATGGACTCACATGAAGTTTAACTAAATTTGAAAGAAATAGATGAT
GAAAGTATAATATGGATAGGGGTGGTGTATCTCAATCACAGAATTCGCGCCAAAGTCTTT
CTCAAAGAGTCTCTCTAGCAACTTCTGCTTAGACTTGCCTACGTGCTCAATGTAGAACCA
GAATATGCATTAGCTCTAAAACCGATGTCGACATCATCAGACCATGTTAATCCTAAAGAG
GAAGAAAAAAAGCCCAAAAAGCTAGCAAAAAAGAGATCCTCATCTTTGAAATAAATTGAC
TATTCTTTCAATTAGGATTCTTCAGATGAGGAAGAGGAGGGGCAAATTATAATTCCCAAA
GATGTTGTAACAAGAATTCAAGATCTTCAAACCGACCAATTTTATCTTGTTTGTTATCTT
CGCCAGAAAACTGAAAATGAATTGGTAGTCGAACAGCAGTAACTGAGGCACTAATTTACC
TTTGAGGAGGATGGAGACAAGAGTGTAAAAATGACGCCCAAAAAATCTATGGCAAAGCTC
TTTGAGACTCAAGGGATTAACATCAATGAGTGTTAACAAAAAGCCAAAAAATCCAGAGGT
GATAAGAGAGTCCTAATTTGCCCTTTTGTAAACTGTTTAAAGGATTTTACTGAGACAGGA
AACCTAAAAACTCATTTAAGAACACATACTGGCGAGAGGCCCTTCGTTTGTAGCACACAA
GATTGCGAAAAATAGTTTATTACAAAAGGTCATCTTAAGACTCATGAATTAATTCATTCA
GGAGATAGGCCGTTCGAATGTGAAACTGGGGAGAAACCTTTCAGATGCAATATCGCTTAA
TGTGGGAAAACATTTACAGAGAAGGGAAACTTGAAAACTCATATGAGAATCCATTCTGGT
GAAAAACCATTTACATGCTCTGTTAATAATTGTGGTAAAACTTTTACAACTTAAGGACAC
TTGACTGACCACATGAGAAGGCATTCAGGAGAGAGACCTTTTAAGTGCACATTTTGCGAA
TAATCATTCATGAGATCCAGCACTTTAAAGATTCACTTAAGACGACATACAGGAGAGAGA
CCTTACGAGTGCCAAGAATGTGGAAAGAAATTTTCAGAAAGTGGAAACTTAAAAACTCAT
CAAAAGACTCATATAAACAAGAAACGAAAAAATAATATATAAGTTACCAATAAGAGCTCA
AATATGTAAAATGAGACAATTAAAAGAAGAGAGAGTAGTATACTACCAGTGAAAGTTTAA
TAGGGCTAAGCTACAACTCTTGGAAAAAGAAAGAGATTGGCAATGAAGCATATTTCAGAC
AACAATTTAATTAAAGCTTCAACTCTAAGTGTTAAGAGAAAGAAAAGCAATTAGGAACTT
TCCAAAATACAGCCAAAGGAATTGAAGAAAGAATCTGTTTAAAAGTTATAGTAGCACTAA
TTAGAGAACAAAATAGAACCACATAATGAAGAACAGAGTTAAAATGCAAATGGGGGATTG
TTGACTCAGAATTAGGTTTTACCAAAAATCAATGAACAGCAACATTAAACTTTGAATCAA
TAATCATAGCAGCTACAACAATAGTAATAAAATAACGCAGCATAGCAGGTTCAAGTTTAG
AGTATCTCCTAGCTCTAGTCTCCCTCGTCACTCAATGCTTAACTAGGATAACCAAATGCA
TCTATGGAAAATGAGAGCATAACTTTACCATTAGAAAGCACCTTTCTTCCTAATCAAATG
ATTCCAGAGTAGTCGCAATCTCCTTAACTTTTCTAGCCCTAATAAGCCTTTAATCCACCA
CTTTTCACACCAAAACTAAATGGTGTTGGGTATAATGCATCTCCCATAAGTTTTACACCA
ATGACAAGCACAAACAATCCAAGCTTTGGTTTCCCTGTTTCTCTAGGAGGGTATTAAACA
CAAAATCAGAATGCACTTAGTACTTCAAAAACAAGAAGAGACCCCACAAGCAAGCATTCT
TTTCACAATTTCTTTGCTTAACTCTAGTCTAACTAAGCATTCAGCAGTGCTGGAATTTAA
AATCAGAACAATAATTAATCTCAAAATTCTATGAACTAGATGATTTTCAATAATAACACA
GCAAGTACTAATCTGAGCAGCAGTACAGCAAACAGACCTCCCTCCCCAAGTACAAATCGC
ACTACATTTTTGTAAGGAAGCAATAATTTCCCTTTTGCTCCAATGAGTCCATAGGGTAGT
AATGTCGAGCCATTTTAGGGAATATTCTCTCCAGAATCGAAAAGATAAGTGCAATTTTCT
AAAAGTGTATAACAACAAATTTAATAGCAATAGTAACAACAATAACTGTAGTAATAGCAG
TAGATCCTTTCTTAAGCATCATAACAGTAGTAATTTGCTTTGTAACAAACTTAATTTTCC
TAATCATAACAACAGCAGTCATCACAATAGTAGTAGTTCTAAGTTCAACAGCAGCAATAA
TAATTCCAGAATGGAGGCACCTAGATTTAACAACAGCAAGCAGCTGGCAACTCTCAGATT
CAGTAACTCCCAACTATGAACTAAATTTCAGGAAGTTAACTTCAAACAAATATTGGTGCT
AATGGTTAGGGATAGAATGGCAAGCATTTATAACTTAGGTCACTTGGCTCTGTAAACTCC
TACTCTCAAATTCCAGGGATGTAAGAGCTTGTGAATACCACCAAGAACTTTCAATCTCCT
CCCATAAACCCCTAACCTCAATTTCACATTAGCAGTAATAACTTGAGTTAATACAATTTT
GGAGGTTTCACCCTGCCTAGGTCCGGACCTACTTCCAAGCAAAACAGTAACAACAACCTA
ATGCCTTTTGACATTCCAATCAGTAAGATTAATCATCCTGAAAAGCTTGGATAGAATGTA
ATGAAGCAATCATCAGACTAATTAGCTTACTTTGACAATAACAATAATAACAGCTTCCCT
AATTTGGCTTTAAATTACAATATCTCTAACAAGATTCAAGGTAACGGGCCATTAATAGGA
GGACCTCCAGGAGCAAATGCAGCTAATGGAAACGGTGATATGTCAAATAATTTTAAGGAC
ATTTAGCTAAATACTAGCATAAGTGGTTTGATGTTGGGGAACACTCCCCACACTAGCACT
AACAATTTGAACATGTTCTTGAATTCGCAGTACAAGATATTCGATTAGGATCAACCAAAT
GCAAGTTTACTCCTTAGTGGGACAACTCCAGCTCATCATTTGCTGCAATAGTAGCAGTCT
TAAGTGCAAATGTAAATACAGCAGCAGTAGTTTATTTAGATGCAGTAGCAATAACAGTAG
CAACCTTAACAAAATGCTTAACATAATCCATTCATGTCTATCAATTAACAGCACCATTAG
CTTGGTTCACTTGCCATGAATTTGAATACTCAACAAGCGAATCCTTCAATATTGCAGGTT
TAATTTCAGTAGCAATAGTAAAACCCAGCTGACTAAGGTGGTAGTAGCATGCAGTCAGCC
AGATAAATCGATGAAGAAAGCTTCTCAAGCATGATGTCAAGAGTTACATTCCAAAAATCA
GATTCAAGAAATCAATAAGACTAGCTATCATAGTAACAGCCTCAAAATTAACCTAATATC
AGCAGCGTAGTAAATCATCAAAAATACAATTAATAACAATAACTTCATCAATCTTGA


>Contig581.1.g61(protein)
MTNVVMDSHEVQLNLKEIDDESIIWIGVVYLNHRIRAKVFLKESLQQLLLRLAYVLNVEP
EYALALKPMSTSSDHVNPKEEEKKPKKLAKKRSSSLKQIDYSFNQDSSDEEEEGQIIIPK
DVVTRIQDLQTDQFYLVCYLRQKTENELVVEQQQLRHQFTFEEDGDKSVKMTPKKSMAKL
FETQGININECQQKAKKSRGDKRVLICPFVNCLKDFTETGNLKTHLRTHTGERPFVCSTQ
DCEKQFITKGHLKTHELIHSGDRPFECETGEKPFRCNIAQCGKTFTEKGNLKTHMRIHSG
EKPFTCSVNNCGKTFTTQGHLTDHMRRHSGERPFKCTFCEQSFMRSSTLKIHLRRHTGER
PYECQECGKKFSESGNLKTHQKTHINKKRKNNIQVTNKSSNMQNETIKRRESSILPVKVQ
QGQATTLGKRKRLAMKHISDNNLIKASTLSVKRKKSNQELSKIQPKELKKESVQKLQQHQ
LENKIEPHNEEQSQNANGGLLTQNQVLPKINEQQHQTLNQQSQQLQQQQQNNAAQQVQVQ
SISQLQSPSSLNAQLGQPNASMENESITLPLESTFLPNQMIPEQSQSPQLFQPQQAFNPP
LFTPKLNGVGYNASPISFTPMTSTNNPSFGFPVSLGGYQTQNQNALSTSKTRRDPTSKHS
FHNFFAQLQSNQAFSSAGIQNQNNNQSQNSMNQMIFNNNTASTNLSSSTANRPPSPSTNR
TTFLQGSNNFPFAPMSPQGSNVEPFQGIFSPESKRQVQFSKSVQQQIQQQQQQQQLQQQQ
QILSQASQQQQFALQQTQFSQSQQQQSSQQQQFQVQQQQQQFQNGGTQIQQQQAAGNSQI
QQLPTMNQISGSQLQTNIGANGQGQNGKHLQLRSLGSVNSYSQIPGMQELVNTTKNFQSP
PINPQPQFHISSNNLSQYNFGGFTLPRSGPTSKQNSNNNLMPFDIPISKINHPEKLGQNV
MKQSSDQLAYFDNNNNNSFPNLALNYNISNKIQGNGPLIGGPPGANAANGNGDMSNNFKD
IQLNTSISGLMLGNTPHTSTNNLNMFLNSQYKIFDQDQPNASLLLSGTTPAHHLLQQQQS
QVQMQIQQQQFIQMQQQQQQQPQQNAQHNPFMSINQQHHQLGSLAMNLNTQQANPSILQV
QFQQQQQNPADQGGSSMQSARQIDEESFSSMMSRVTFQKSDSRNQQDQLSQQQPQNQPNI
SSVVNHQKYNQQQQLHQS