Identifiers and Description

Gene Model Identifier

Contig7036.0.0.g59

Standard Name

ZNF1ah

Aliases

Contig7036_0_0_g59

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002392603.000842737734004e-34Zinc finger, C2H2 type family
protein
SGDYOR113W3.998609120989657e-17AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7036.0.0.g59(coding)
ATGAGTTCAGAGTCTGAAATTTCAACAGAGTAAAAAGAAGACTCAGAATATGAAAATAAA
CCAAAAATAGTAAAAAAAACTAAAAAAATAAAGAAAAGTTTGAAAGTCAAGAGTAGTGCG
AGTAAAGTTTCCCCTAAAATTAAGTCTAAGGTAATTGTCAAAAAGAAAGGCAAAGTGTAA
ATTTAAAACAAGAAAATTAAGTAGAAAGTTAATAGCAATATAAAAGCAACACCAAAGTAA
AAACTTAAAGAAACTGCTCTTAAGTAGAAAATAAAATCTAAAAAGAAATAACTACTCAAT
AAAATTGTCAAATTAGAGGAAGAAGAAAAATCTATAGTTGATTTAACAGATGAAAAAGAC
GAATCATATTCAATCTAAAAAGTGACAAAAAAATAGAAAGCTAAATAAAAAGTTAAAATA
ATTGAAGCAACTGAACTTAAGAAGAAGAATTTAAAATAATCAAAATTAAAGAAAAAGTTA
AAGAAGAATAGTTTATTACAAAGAAAGAATCTAGCGACTAAAGTAGAAAATGACACAAAA
GATAAATGTAAATAAATAAAAGTACCTAAAACTAAGATTATCAAAAAGAAGAAATTAAGA
ATCAAGAAGAAAAAGAAAGCAAAGACTATTAAAACATAAGTGCTTATCAAATAAGAAGAG
GAAGATAAGGTGTCTGAAAAGTAAAATAATTCTGTTAAAAACATTAAAATTGAAAAATCA
AACTAATCTCAAGAAAGCAGTGAGTAAAATAATCTAGAAAGTCTTGTAAAAACCGAATCA
TAAGAAAATGAAAGTCAGGAAGAAGTTCAAATTAAACCAAAAGTAGTGAGAGCTGCTGCT
AAGTAAAAAATTAACTGTAGTGTGTTACCTTCACTTAAGATAGATGTAGATAAGAAAGAA
CTTATTCAAGAGGAGCTTATGACTTAAGTAACGAGTATTGATTAATCAAAAGTTCCAATA
AAAGTTGAAGAAACAATTGAAGAATAGCTTAAAAAACTTAAATCAACTATAGTTGGAATG
AAAAGAGCTAAGAAAAAGAAAACTCTAAGATTGAATCCTTTAAGTTAAAATGGAATCTTG
AATTTTCAAACTACTTAACAAAATTAGCAATAGATCTTGAAAAGTAAGTTGAAAAACAAA
ATTCGAAGTAAGCTAAAGACTTTAGGCAAAAGATTCAGCAATAATTCTAGATCCTCAAAA
GCAAGAGGAAATTTTGGTGATAGCGACTCTCAAAGCTCAGATTAACAGAATTAAAAAGCT
AAATTTAAGTCTAAATACATCGAAGCAACTGGCATGACAACGACTTCCTCTTCGGAAGAT
AACTTTGAAGAGCTCTACTGCGATATTTGTCACAATGGAAAAGTTTATACAAGCCAAGCA
GCTTTAAAGAAACACCGACATAATCATGAAGCAAAAGATACCTGGCCTTGTGATTACCCA
GGGTGCAATGCTAATTTCTAAGATCGAAACAAATTAAAACGTCACTCAATAGTACACACT
GGTGAAAAGCCCTATGTTTGTGAAATTTGCGGCAAAAGATTTGGGCTTGAGTACAACATG
TTTATTCATTAAAGAATACACACTGGAGAGAAGCCTTTCTAATGTAAGTATCCAGGATGC
TTTAGAGGATTTAATCAGAAGAGCAACTTAGCTGCTCATGATAAAACTCATCATAATAAT
GCAGGAAACCCCAATAATCTGGTTAACAAGTCTAATAGTTACTACTATTAGAGAAAGTAG
AAAATTTAGGGTGATTTAAATAGTAATTATGGATCAGCATCTGACAGCTAAAACTCAAAT
CAATTCTAGATTATAAGACAAAACTACAGAGAGGACCCTCTAAAACATTACAGAGGACTT
TTGATTTAAAACCCTAAAAAGGTCATATTTAAAATCACTAAAGTGTTCAGAGATGAACAA
GGTAATGAGATAGTCTAAGAGAAGTGTGCTCAAGAAAATCAAAAGAATATTCTAGATAAT
ATCCCAGAGAAAAATAATTCAAGTTCTACAACTGCAAATTTGTAAATAGAAGTATAAGAA
ATTAGTAAGAAGGAGAACTTTTTGTAAATGTTAAGCAGTTTTCAAATGATAAACAAAATG
AAAAGATTCTAAGAAGATGACTTGGAAATGCAATTTATTAGTAATAAAGTGGACTTTGAT
TAATCATATGTTTAGCCTAACTTTGATAGATTAATAAGAAAGATATAAGAGAAAAATACA
AATATCTTCCAATATTAGATGCTGCAATATAAGAACGATAAGAGAGCTTAAAAATTCTAA
GAAATGTCTAAGAGATTGCTAGATTAACAAAATGATAAATTAAGCAGTATTCCATTAATT
AAAGTAGAATGA


>Contig7036.0.0.g59(protein)
MSSESEISTEQKEDSEYENKPKIVKKTKKIKKSLKVKSSASKVSPKIKSKVIVKKKGKVQ
IQNKKIKQKVNSNIKATPKQKLKETALKQKIKSKKKQLLNKIVKLEEEEKSIVDLTDEKD
ESYSIQKVTKKQKAKQKVKIIEATELKKKNLKQSKLKKKLKKNSLLQRKNLATKVENDTK
DKCKQIKVPKTKIIKKKKLRIKKKKKAKTIKTQVLIKQEEEDKVSEKQNNSVKNIKIEKS
NQSQESSEQNNLESLVKTESQENESQEEVQIKPKVVRAAAKQKINCSVLPSLKIDVDKKE
LIQEELMTQVTSIDQSKVPIKVEETIEEQLKKLKSTIVGMKRAKKKKTLRLNPLSQNGIL
NFQTTQQNQQQILKSKLKNKIRSKLKTLGKRFSNNSRSSKARGNFGDSDSQSSDQQNQKA
KFKSKYIEATGMTTTSSSEDNFEELYCDICHNGKVYTSQAALKKHRHNHEAKDTWPCDYP
GCNANFQDRNKLKRHSIVHTGEKPYVCEICGKRFGLEYNMFIHQRIHTGEKPFQCKYPGC
FRGFNQKSNLAAHDKTHHNNAGNPNNLVNKSNSYYYQRKQKIQGDLNSNYGSASDSQNSN
QFQIIRQNYREDPLKHYRGLLIQNPKKVIFKITKVFRDEQGNEIVQEKCAQENQKNILDN
IPEKNNSSSTTANLQIEVQEISKKENFLQMLSSFQMINKMKRFQEDDLEMQFISNKVDFD
QSYVQPNFDRLIRKIQEKNTNIFQYQMLQYKNDKRAQKFQEMSKRLLDQQNDKLSSIPLI
KVE