Identifiers and Description

Gene Model Identifier

Contig2976.0.g15

Standard Name

ZNF1ad

Aliases

Contig2976_0_g15

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR113W4.0009493637353324e-18AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...
T. thermophilaTTHERM_002955602.0004286606204839e-16Zinc finger, C2H2 type family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2976.0.g15(coding)
ATGTTAATGAGCAACGAGTTAAGCAGAGAAAATTCGGTTTAAGAGAAATCAGTTTAAATA
GAAAATGAGAGCCCACAAAAGTTATAAAATTATATGAATTAAAACTCAATAGCAACCCCT
TTCTCAGACAGGCCAACCATGCCTGGCACTCTCCACAAAGATTACGAGTAAAATGTATAA
GACTGTTCGAAAATAGTGTCTCACTTTGATTGTGGAGTAGAAGGGGGTATCTTTACTTTA
TAAAAGCTTGAGTCCAGTGACGAAGGCAATTGTTATATCCAAAGCAATTAAGTTGAGAAC
ATTAGTAAATAAATTCAGCAAAATATTTTCAAATATTCAGGGGATATGAGTGAGCACAGA
GACTTTCCAGGGTCTAACAATGCCTCCCAATTCTTAAGGAGCGATGATGATGATGATTTC
TAAATAAGTCTTATAGACTAAGAGAGCTTAGAAGAAGCTTCAAAGTTAGAAAATAACTAT
AGCATGGATTCTACTTTTAAAAATCATTAAAGAAATATTTCAAATTCGACAATATTAAGT
GATAGAGTTGAAATAGAATCTAAAAATGGAGGCAATAAACAGCATCTTATTTATCAGTCT
CAAAAAGTTAGCTCAAATAATTTAGAACCTTCAGACTCTTTTAATGGATAACAAAATTTA
TCGTTCCCTTTTAAAAAGTTGGATACCAATTCAAATCGACGGTAAATATTACCATAACCT
TGTTCCTTAGCCAGAAAGTTTAATTACAATGCGGCAACTGCTAATAATTAAGAATAAGCT
CGAGTTTTACCGAAACTTGAACCAAGTGATTCAATAACTAATCAAATGTCAATACTTAAG
CCAACTGTTGACTTTGATTAGCTCTTTATGAGTTTGAAAAAAATTGAGGATATAGTTGAA
AGCGTTGATAATCACAATATAAATCTTTCAAAAAAATAGTAATCGCTAAATTAGATAGAG
AATTTTACCTTGATATCTAATACTAAAAGTAGAGATATCCACTTAACGGATTTCTAAAAG
CAACACTAAGATAAATCCACTAATTAAAATGCTTTAATTCCTCAATGTCCTTCTCAGACA
TTATGTGATAAAAGTTCTGTTAAAATGGATAAGAAATTTTAAACATCAGGATTCATGTAT
CTAAAGGAAGATGATCTAAATGAAAGGGTTAATGATTCTCAATTAGAAAACATTAATGTA
ACTTTACCACCTGCCTAATTTGGAGTCAAACGGTCATTTGCTTAATACAAAGGTGGTCAA
TATTCTTACTAGAAAAGTTCTTAAATATTCAAATGCGATATCCTCGGGTGTAACAAACAA
TACTCAAAGAAAACTGTCTTAGAAACTCACAAACGATAAAAGCATAATACTAATTAGAAT
TATACTTGCCCCTAGGTTGGCTGTGAAAGTTTATTTTTTGACAAAGTATCCTATAGAAGT
CACAAAAGATCTCATGCTTAGATCAAAGAATTTTCTTGCATAAAATGCTTCAAGAATTTC
ACAACTAATGGTCACCTAAGAGACCACATTAAGAGTGTACATGACAAGACCAAAGACTTC
AAATGTACTTATCATGGTTGCACAGATAGTTTCGCTCGCCACAGTGTTTTGATAGTACAC
ATGCGCAAACATACTGGTGAGAGACCCTATAAATGCAATCAATGCGAGAAGGCTTTTACT
GAATCTGGAAACCTTAAGGTTCACAAGAAAACTCACAATCAACAAAATGAAAGGAAATAT
GTTTGTAAAATCGAGAGCTGTGGAAAATCGTTTCTCAACAAATGTCAAATTCAAACTCAT
TATTTATCTAAGAAGCACATCAAACTGTTAGGATAGTTACCTCAAAATGAACTTGTTGCT
CTTAATATCTCTTAAGAAGATATTGAGAAAGCTCTCTAGAGCTATGAACAAAAGCCAGTA
AAAAATGAAACTTTAGTTTAAAACTAAGATTCAACAGTTACACAACAAACTGAATCTGCT
CTAGCTGTTAATCATAAAGCAAAATGTGAACAAACTTAAATGAAGGAGTCTCTTCAGGAC
TTCTTATCTTAATAAGTTGAAAATCTTAAACTTAAAGTAAAAATTGAGTTAACTCAAAAG
TAAAATGTTGATCAAAAAAAGGTTAAACCTTCAGCGAAATAAAGCAAAAAGATTCATAAA
AATGAATAGATTCTTCAAGACCTTGAAGATATCAATTGTTCAAAGTATTCAAGCTCAAAC
AGCTTAGCTCTACTTAATAATTCCTTGCAAAATTAATCTCAAAATTCAAATCTATTATTT
GGATTGGATTAGGATAAAGTCTATTATAAATTTGAATAATAAGTAAGAAGTTTTGATCAG
ATGAAATTATCATCTGTTCAATCTTCCCCATTCAAGCTCTCTTCAATTCCTAATAATAAT
ACTATTATTTTGGAAAGTGAAGAGGCTATTTAAGAAAATTCAAAGAGACAAAGACTCTAA
TGA


>Contig2976.0.g15(protein)
MLMSNELSRENSVQEKSVQIENESPQKLQNYMNQNSIATPFSDRPTMPGTLHKDYEQNVQ
DCSKIVSHFDCGVEGGIFTLQKLESSDEGNCYIQSNQVENISKQIQQNIFKYSGDMSEHR
DFPGSNNASQFLRSDDDDDFQISLIDQESLEEASKLENNYSMDSTFKNHQRNISNSTILS
DRVEIESKNGGNKQHLIYQSQKVSSNNLEPSDSFNGQQNLSFPFKKLDTNSNRRQILPQP
CSLARKFNYNAATANNQEQARVLPKLEPSDSITNQMSILKPTVDFDQLFMSLKKIEDIVE
SVDNHNINLSKKQQSLNQIENFTLISNTKSRDIHLTDFQKQHQDKSTNQNALIPQCPSQT
LCDKSSVKMDKKFQTSGFMYLKEDDLNERVNDSQLENINVTLPPAQFGVKRSFAQYKGGQ
YSYQKSSQIFKCDILGCNKQYSKKTVLETHKRQKHNTNQNYTCPQVGCESLFFDKVSYRS
HKRSHAQIKEFSCIKCFKNFTTNGHLRDHIKSVHDKTKDFKCTYHGCTDSFARHSVLIVH
MRKHTGERPYKCNQCEKAFTESGNLKVHKKTHNQQNERKYVCKIESCGKSFLNKCQIQTH
YLSKKHIKLLGQLPQNELVALNISQEDIEKALQSYEQKPVKNETLVQNQDSTVTQQTESA
LAVNHKAKCEQTQMKESLQDFLSQQVENLKLKVKIELTQKQNVDQKKVKPSAKQSKKIHK
NEQILQDLEDINCSKYSSSNSLALLNNSLQNQSQNSNLLFGLDQDKVYYKFEQQVRSFDQ
MKLSSVQSSPFKLSSIPNNNTIILESEEAIQENSKRQRLQ