Identifiers and Description

Gene Model Identifier

Contig8620.0.g9

Standard Name

ZNF1aa

Aliases

Contig8620_0_g9

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002955603.999374135750469e-31Zinc finger, C2H2 type family
protein
SGDYOR113W3.9983110956465888e-22AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8620.0.g9(coding)
ATGTTTTTCGATTGCACATAAGACGGTTGTGGAAAAGTATTCAACTGCAAAAAGGCTCTA
AAAGAGCATGAAAGAACTCACAATTAAGATAGACCATTCAAATGCGAGCTATGCGACTAG
ACTTTTACACAATATTCCTCACTTCAGAAGCATGCCAGAGTTCATGATAAAAAGAAGCCT
TTTAAATGCTCTACTGACGGTTGCTATTAAGCATTCTCACAGGTATCGAACTTGATTCGA
CATCAACGTATTCACACTGGTGAGAAACCCTATGAGTGTGAAATATGTGGAAAACAGTTT
GCTTCAGGTTCAAATCTTAAGCAACACATTCAAATTCATGATCGACAGGAAGCTAGAAGT
CAATATAAATGCATCTTCGAAGGATGTGATAAAAGCTATCTATATCCATCATCCTTGAAA
AAACACTATACTGTGAGTCATAAGGAAGAGTACTCCTAGTACCTACAGGACAGAAAGATT
GAAACATGTGGATTCCATCTTAAAGACGGCTAAACGATGCTAAATGATGATTACAGCTTA
GATGCCTTTGGACTAAAGGATATCGAATAATTCAAAATTTATCATCAGAATACGTTTGCT
CAATAAAATTAACATCATCAGCACTTATCCCAACCAAATTCACAAGCTGCAACCTTGCAA
AACCAACCATAGCATTACTCACTAGAGTAGGCCATAAATTAGCATTATAATCTAGCCCCA
GCAGCATCAAATTCAAGCCATCACAAAAACTAGATATAGAACCAACTCAAACATTCAAAT
ATTGATATAGGGGGAGTAGGAAAAAGTTAGCACCTTGACGATCAGCATAGAAACTATTTC
TATCATAATTACTAAGGCACCTTAAATCCAAACCAATACCAGCAGCAACTTACTCATACT
ACCAATTAAAATAATAAATTTAAGAGCCCAATATCTACAATTGGAGCATAAAATATATAT
CTTGGTGGAAATACATCAGGCTCAGGCAGCAATAATGCTAATTAATCATTACTGCCAAGT
AAAAGACATTCAAAGCATTTAGACTAGTCTAATCTACCATAAACTCAATAGCAGTCAAAA
CTTGCAGGAGGCAGTAGCTACTAAGAGTCACAGTATTTGCCACAAAAATAATAGCAATCT
TCGACTTAAAATTACAACATCGATCAGGAAAATAGCAATGCTTAAATTTAGCAACAAATC
GGTAACAAAAGACAAAAAATAAATAATCTCAATGATAATTTTCAAGCCAACTCCACTCTT
GCTAATATTTTATAGTTGTCTACATCCCAGCTAAATTAGAATGATAGCGCCAGTGGAGTT
TAATCAATATTTCACACTTCAAATAATGTCAACAATAATTTACTTAAGCTAGAAAATGAT
GAGTAGTCTGTTGATGCCAATAATGAGAAAAATAAGTAAGTAACTTAATTCCAATTACAA
GGAGAAGACTGCTCTCTGTCAAAGGATAGTAAAGAAAAACTACCTAAAATCGAGGTACAA
GATGCAGACTTGATTTCAGGGACTGACCTTTCTAAGGAAAAAACTCTCAGAAATCTTGCC
AATAGTGAATAGGAAAACAGTTCTGGTACTAATAGCAAACAGCCTTTGAACAACGGTGAA
AATAATAACAGCATTCAGCAAAATGCTCAAACTATTATAAATAATAGATTCATTGATCCC
TCACTTAGACATCAAGATACCGTCTACTAGAACCATTTGATAAACTAAGTCCATTCGCTC
TTAGAGCAGCAAAACTAGATGTTTAACAGAGCTATGGAGTCATAGTAGGTACTAAGTAAC
ACTCAAGGGATATAGCACACAGGACCAGGCATAGTGGGCTAGAGTGGTATTATTGGAGAC
TAGGGAAGTAGTGCCTAGTAAACTCCTAAATTTATGCATTCCCATAGCACAGGGCCAATT
CTTCAAAACCCAGCTCAAGACACCAATTTACAAGCATCTATGCCCTTGAATTTCTAGAGA
CACTTCATTAATAGCAACAACAACCTTAACCATGTTCAGCAGTACCAAAATTCAGGATTC
CATCAAACTTCTGGTTAAAATTTATAACAATAAAACTTACTTTAATAAAATTATACTGCT
CTCTAGCAATAACTCGCCTTAAATTAGCTTCACTTTAACACTATTACTAATAGCAACCAC
GGTTCTTATTTGGACAGAATGTCTAATCACGGATCCCACTCTATGATGAGTCCATCTGTC
TACATTAAGAAGCCGTCCCCTCATTTATTGAACCTATAGAATCAGCTAAATCATGGAAGT
GGCAATTCCTGTCAATCAAGTTAATTTATAAGACAAAATCAAAACTAGCAAATGAGATAT
AGACAAGGGTAAATGATTGGTCAAAGCACTGCAAACAGTGGCATTAATTTAAGAGATTTG
CACAAGCCTAAGCCCATGAGAGAGGTGTCTTTTGGCTAGTAACAATAGAATCTTCCTTAA
TCATCCTTCGGTCATCAAAACATGGATGTAAATTTGAACAATTTGATGCAATAAAACGCA
AATTCATAACAGTAGTAAAAAACATTGCTCTAAGCTGAAATAGAGAATGACTAAAGTCTT
TGCAATTTGGCCTAATAAGTGCAAAATAAGCAAATGTAAAACGAAATTAAAAATGATAAG
ATTTCAGATGTAAACTCCATTGCTTCACAACTTGGGCTTCCACATGACATCGAAATTCCC
TCAGACCAACAATCAGTAAATTCACTTGAGGGTAGTCACAATTCAAGCAAAGTAAACCAA
CTTAATGAAAGTAAAACATCGAATGAATCTGGATTCAAATAAGTTAACAAAATGTTCTAA
CCATAACCAAACGCCAACTCGGGACTCTTCAGTATGATGGCCAATCAACAACCAAGCAAT
ATGGTCATGAAGAGAAGCAATTCAACATCTGGAATATTAAGTAACTAATTGCTAACAAAT
GACTCAATTCGCAAATCTAGTTTCTATCAGCAGTAGGTGAACAATCTTTTGAAGCAAGGT
TACAGTAAGAACTAAATTCAAAACATGAGCAACCTAGATATCGGAAATTTCGATCAACAG
TCTCACTGTTCAAGCTAGAATTTAGAATCTGCAAATTTAATGTCTCTAGGCAACTATACC
GACTAACTTCACCTCATTCAAAGTAAAATTTAACAAGTTCAGCCTACTGGAGGTTTGGCA
TAGTAAGAGAGAGAAGAATAACTAAAGAACATTTAAGAGACTAAGGAGTGA


>Contig8620.0.g9(protein)
MFFDCTQDGCGKVFNCKKALKEHERTHNQDRPFKCELCDQTFTQYSSLQKHARVHDKKKP
FKCSTDGCYQAFSQVSNLIRHQRIHTGEKPYECEICGKQFASGSNLKQHIQIHDRQEARS
QYKCIFEGCDKSYLYPSSLKKHYTVSHKEEYSQYLQDRKIETCGFHLKDGQTMLNDDYSL
DAFGLKDIEQFKIYHQNTFAQQNQHHQHLSQPNSQAATLQNQPQHYSLEQAINQHYNLAP
AASNSSHHKNQIQNQLKHSNIDIGGVGKSQHLDDQHRNYFYHNYQGTLNPNQYQQQLTHT
TNQNNKFKSPISTIGAQNIYLGGNTSGSGSNNANQSLLPSKRHSKHLDQSNLPQTQQQSK
LAGGSSYQESQYLPQKQQQSSTQNYNIDQENSNAQIQQQIGNKRQKINNLNDNFQANSTL
ANILQLSTSQLNQNDSASGVQSIFHTSNNVNNNLLKLENDEQSVDANNEKNKQVTQFQLQ
GEDCSLSKDSKEKLPKIEVQDADLISGTDLSKEKTLRNLANSEQENSSGTNSKQPLNNGE
NNNSIQQNAQTIINNRFIDPSLRHQDTVYQNHLINQVHSLLEQQNQMFNRAMESQQVLSN
TQGIQHTGPGIVGQSGIIGDQGSSAQQTPKFMHSHSTGPILQNPAQDTNLQASMPLNFQR
HFINSNNNLNHVQQYQNSGFHQTSGQNLQQQNLLQQNYTALQQQLALNQLHFNTITNSNH
GSYLDRMSNHGSHSMMSPSVYIKKPSPHLLNLQNQLNHGSGNSCQSSQFIRQNQNQQMRY
RQGQMIGQSTANSGINLRDLHKPKPMREVSFGQQQQNLPQSSFGHQNMDVNLNNLMQQNA
NSQQQQKTLLQAEIENDQSLCNLAQQVQNKQMQNEIKNDKISDVNSIASQLGLPHDIEIP
SDQQSVNSLEGSHNSSKVNQLNESKTSNESGFKQVNKMFQPQPNANSGLFSMMANQQPSN
MVMKRSNSTSGILSNQLLTNDSIRKSSFYQQQVNNLLKQGYSKNQIQNMSNLDIGNFDQQ
SHCSSQNLESANLMSLGNYTDQLHLIQSKIQQVQPTGGLAQQEREEQLKNIQETKE