Identifiers and Description

Gene Model Identifier

Contig15525.0.g58

Standard Name

ZNF1a

Aliases

Contig15525_0_g58

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam13465 ) Zinc-finger double domain
  • ( pfam00096 ) Zinc finger, C2H2 type
  • ( pfam13894 ) C2H2-type zinc finger
  • ( pfam02176 ) TRAF-type zinc finger
  • ( pfam00418 ) Tau and MAP protein, tubulin-binding repeat
  • ( pfam13912 ) C2H2-type zinc finger
  • ( pfam02748 ) Aspartate carbamoyltransferase regulatory chain, metal binding domain
  • ( pfam09237 ) GAGA factor
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)
  • ( pfam08790 ) LYAR-type C2HC zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002955602.998800627344286e-26Zinc finger, C2H2 type family
protein
SGDYOR113W1.9999391735788327e-19AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15525.0.g58(coding)
ATGAATGGACTCTAGCAAGACACCGTCTATAATCAACATAAGTTCTAACAGTCAGAGGAA
TTTTATCTCTTGAACTCCCTGAATGAATAGTATTTAGGCAAGGAGGAATTTAGAAGCAAT
AGCAGCGGCAAGTATCAATGTCACTTTGACGGCTGCCTCAAGATATTTAACTCTTAATCA
TCTCTTTCCAGGCATAAAAATGTACATCTTGGAATTTAACCATATACATGCCCATTCCCT
GATTGTAAGAGCAGATTTTCTCAAAGGACTAGCTTGAGACATCACGTAAGAACTCACACT
GGTGAGAAGCCGTACACTTGCGATTACTGCGGGTGGGCATTTGCCACAAAAGGAAATAAA
ATAGATCATGAGAGGAGACACCTTAAAATTAAGCCATACAAGTGTACCTAATGTCTGAAG
CCTTTCTACAGGCCTCATTAATTGAAATAGCACTAATCTAAGTGCGGCTCACTATCTAAT
GAATTTTTACTTAATTAAGAATTCTAAGATTAAAATTAATTGCATCAATAAAGTTTGGTC
TTTGAAAATACGAGAAGAGATCTCAGCAACTTTAATGGGCTCTCAAAAATGGATTATAGT
TAGCTTTCATAAAATCTTAATAATAATATTGATTTGGAGTTAGAGCAAGAAAATGCTCCA
ATTGCTCAGTATTTCAAACCTTTTATGCTAAAAACTACAATGGATTTGCAAAATTCCCAT
GTCAGTTATGCAAGTTTTGACTGTCAAATAAGATTCGAGGGTTTAGGATCAGAGTAAAAT
TTATATAATTAATTAGAGGATCTGAGAGCTCAATTTCTCAATACTAAACTTAATAGCCAA
ACAAATATATAAATTTATTGA


>Contig15525.0.g58(protein)
MNGLQQDTVYNQHKFQQSEEFYLLNSLNEQYLGKEEFRSNSSGKYQCHFDGCLKIFNSQS
SLSRHKNVHLGIQPYTCPFPDCKSRFSQRTSLRHHVRTHTGEKPYTCDYCGWAFATKGNK
IDHERRHLKIKPYKCTQCLKPFYRPHQLKQHQSKCGSLSNEFLLNQEFQDQNQLHQQSLV
FENTRRDLSNFNGLSKMDYSQLSQNLNNNIDLELEQENAPIAQYFKPFMLKTTMDLQNSH
VSYASFDCQIRFEGLGSEQNLYNQLEDLRAQFLNTKLNSQTNIQIY