Identifiers and Description

Gene Model Identifier

Contig13519.0.g91

Standard Name

ZGRF1

Aliases

Contig13519_0_g91

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007263003.0013534825799953e-36phage head-tail adaptor, putat
ive family protein
SGDYLR430W9.99723014177113e-33SEN1 SGDID:S000004422, Chr XII
from 993434-1000129, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13519.0.g91(coding)
ATGAACAAAAATAAAGCAAGGAAACCGCTCCATGATTACTCAACAGAAAACGTGACCCCT
CCCCAACCAGATGCTGTCCCACACTCATAATTTCAATGCTAAAAACCTTTCACTGTACCA
ACGAGTGAAGGTTTGTTACAATTGGGTCCTAATGACAAAGTTTCAATAGATGTGGAGTAC
TACGATGTGATGTACACTAAACATTTGCAGTAAAAACAGAAAGTCTGGGAAGATGGGTTC
ATGGAGTATCATATCAAAAATTCAAAACTTATTTTGTTTGCGAGAAACTGTAGAGCTAAT
TAACTTGACAATAAATTCTTCAGATTACTGCCTGATTTGAAGGAAGATGAAGAATTTAAG
CTAAACAAGTACATTGTCAGAATTGAGTAAAGGAGAAAAGAGGGCAAAGTTTCAGTGAAG
AGGGAATCACAACTTGAGGCGAGAAGATCAAAATCTTCTAAAAGCAAATTTGATCTTGGA
AAGTAAAGCCCTTTGATGATCAAAGGTGAGAAGACAGGATCTGTAGGGAAAGGACTACCA
ACTGCGATGAATGCATTCCCTAAGAGAACTGGAATGGGATTCAAGAATAGAACTTTTGTC
TGCCCTTAAAAAGTTAAGGAACCTGAGCTCTTAAATTCAGACAGCGATAACGATTAAGAT
GAATAAGAAAATTTAAGAAAGGTTCACTAGCAGAGAGAGCAAGATAAATTGAGGGAAATT
TAATAGAAATAAAATTAGCATAGAAATGAGATCTTAAATTAGAATGGCATTGGAGGGAAT
TCAATTTATCCAATCAAACAGTAACAAGAAAGATTTTCATAAGAAACTAGTGGTAATGCT
GAATATGATCAGTATTTGAAGTAACTTGAATAACGAAGGAGAGAAGCTCAAGAAAGAAGA
ATGGCTGAGCAAAATCTTAACTCTAGCATCAACTTGAATCAGATCAAAGCTTTAGAGCAA
TAAATTATAAAAAATGATCTTGACATATACTAAGATTCAGGAGATGACGAAGAGGAAAAA
TTTGCACCTACAGGTAACCTTGATAGTACAGATTTTCAATAAAATTTAAGCTTAAACATT
GTAGAAAATCATCCAAATCAGCAAGATAAACCTAAGAAAAAAGACTTGAAAGATTTAAGC
TCATTTATTAAGCAAATTGCAGCGAACTAAGGACTAAGCGTACCTCAGTCTACAGAAATT
GACCCAGAAAAACGAAAAGAGTTTGAAAAGCAATATTTAGCTTTTCAAGATATTACAAGG
AATTCGGAAGAAGCATAAAAATTGAAGAAAAGTGATCCTATTACAGATTTGTATGAGTTT
GATTAGAGCGAGGAAGAACAAGATGAGCCAAGGGAATTGCCTAAAGTTTTAAAGAATTAG
AGCTCTTTAGAATCATAGTAGATAAACAAAAAGAGAAAATTTGATGAATTCCTTAAAGAG
ACTTAAGATCCTGAGGGACATCACGAATATGGAAAGTTCAATTCAACTGCAGTTGAAAAG
AAGATTTCCTCTGGAATGAAGAAAAGATTGCTTACTGATCAGATTTAGAAGCAAAATGCT
CTTGATAGATTGAAGGAAATTCATGAGAAAACAGTCTCAGACAAGAATCAATCCATCAAA
TCCTTTAGTGAGGCAACTTTAGATTTTGCAGTAAGACACCCAATTTATCAGTTTCCAAGG
GACCAAGTTTTACATAGTAGAGAGTCTTATGCTGGGTTTTACATCTTAGCAGTTTTGGAA
ATGCTCAAGTATTCCATCAAGGAAGATTATGATAACTAGAGAACTGAGATGTAACTCATT
CCAATTATCCTAGAGTACACAAAACCATCGTAGAGTCATTAAAGAGTTCTTTAAAATGCA
AACTTCAAGAATATTCAAAACAGAATGAAAAAGAGAAAGTAAGCCTTTAAGAAGAAAGGC
AAAGGAGCAGGAGGACTTGCAGCTTAAAGATAAAATGAAGAGGAGTCATCTTCTGAGAGT
GAACAAGAAGAAAATCATAATAGTGGAGATGAGTCAGATGGAGAAACTCCCGGCTCTTTC
TATGTAAAATTCAAGGATTTTTTACCACCTCTTGTTAAGAAAGATATGATGGTTGAAGAT
TTATGGATCTTAATGAAGAGACCTATGGTAACAAATCAAAACCTAGCTGATGTCTCGGAA
ATGCTTTTCGTCAAGAATTAATGGCATGGTCATAATAAGCAATTGAAAATCAAAGTTTCA
ATTATTGGATCTGTAGATGAAGTTAGAAACAAAGTGGATTAGTATAAATATGCATTCAAG
TCTGTTAATCTAAATGGATTTTCAAGTTTAGTGGAGAATCTTATTGAGTTTAGGGAAAGA
TCAAACCCTTATGTTGACAGTATGCTGTCAATTAAGAATTCAAAAGCCAAGTTTAAGGTG
TTAAAGAAATGTGATAATTTGTTAGTTGAGGCAGTGAGATAGACTACATGCATACAATTC
AGGTTAAACAGAGATTAAGAATGTGTCCTAAATGAAGTTACCAAGTGGTTTTTAGCAAGA
TCTAAGACTAAAAATAATGAATAAGCTATTGACGACATTTTAGGTGGACTTGAGACTAAT
TCATAACAAAAGAATCCTGATGATCACTCAAATGTTATTTTAGTGCATGGAGCTTTTGGA
TGTGGAAAATCTTACTTGCTAGTGGCTATAATTAGATTTATCTGCACTTTACTTGATTAA
ATTGGTGATACTCAAGTCAAGATTTTAGTCTGTGCTTTAACAAATATTGCTGTTGATAGA
ATCTTGCTCATGTTGAAGAATTCAGAATTTGAAGATTTTGCGAGAGTTGGATCTCTAAAG
AAAATTAACAAACATCTATTAAAGTACACGCATCACTCTGCTTCAAATAAAAAGTAAGCT
GATAAGGAAGCTATAAGAGAACTAGAAGCAATGATGGAAGAAATAAGATCTTCAATAAAT
CCTAATGGTAAAATGAATTAGAATCAGTATGAAGAGCTTATGAACATACAGGAAAGCATA
AATCATATTAGAAGCCAAACTATTCAGCAAAGAATTGAACTTTTAATGCAAAAGAGAGTT
GTAGGAGCAACATGCGCATCCACAGGTTTTGAAGTGATGAAGAATATGCAGTTCAAAATA
GTAATACTTGATGAATGTTCATAAATGCTGGAGCCTTAGAGTTTACTTCCCATCTCAAGA
TTTAACTGTAGAAAATTAATAGCTGTAGGAGATCCATTGCAACTTCCACCAATTATTTCC
TTCAATTTTAAGGAGAAAAAGCTTCATCAACAGTAAATCTTAGAAGAAAGTAAGAACAAA
GTCAGAACTTAGAATATGATTCCTCATTTACCTTTGTTTGTTCGACTAATGAAAGAACAG
TTCTATTGCATTCTTTTGAGAACTCAGTACAGATGCCATCCAATGATAGCTTAAATTGCT
AATGACTTATTCTATGAGAATTACTTAGAGAATGGAGTTAAAGCAGATGCCAGAAAGTAG
CTTATCAAAGAATTTCAACCTGTTACTTTTATTTCAGCAGAGAAAGGTTAAGAATCAAAG
AGTGAGTTTTCTTACAGAAATTACTATGAAGCCAAGTTCATAGTTGCTCTTCTTGACTAT
CTATGCTGTTTGATTTGTCAAAAATACTCTGGTAACAAGCAAGGTGGCTATGAGTCCTCA
TCGTCTTCAGAAGAGGAAGAAAATAAATCTCCTCAAAATGAGAATTAATAGAATGATGCC
CCAGACTTTTCCATAGGAGTGATCGTGACCTACAAATCTTAAGAAGAACTTATCAATTAA
ATGATAATTGACTCAAAGAATGAAGCCCTAAAAGCTATTTAAGTGTCCACTGTAGATGCT
TTTCAAGGAGCTGAGAGAGATATTATCATAGTTGGGTGTGTGAGAACTAGGTCACTTGGT
TTTATAGAGGATTGTAGAAGGTTAAATGTAGCTATAACTAGAGCGAGGAGACATTTAATA
GTAGTGGGTAAAGAGACCCTCCTCACTTAAAACTGCCATTGGAAATATATCATTGATAAG
GCCAAGAACAAAACTGATAAGGTTTATGGTTATAAGAAAGTTAATGATTTCATAGAAAAA
GGAGGCTTATTTAAACATATGCTTAAGGATTTCTAGTGA


>Contig13519.0.g91(protein)
MNKNKARKPLHDYSTENVTPPQPDAVPHSQFQCQKPFTVPTSEGLLQLGPNDKVSIDVEY
YDVMYTKHLQQKQKVWEDGFMEYHIKNSKLILFARNCRANQLDNKFFRLLPDLKEDEEFK
LNKYIVRIEQRRKEGKVSVKRESQLEARRSKSSKSKFDLGKQSPLMIKGEKTGSVGKGLP
TAMNAFPKRTGMGFKNRTFVCPQKVKEPELLNSDSDNDQDEQENLRKVHQQREQDKLREI
QQKQNQHRNEILNQNGIGGNSIYPIKQQQERFSQETSGNAEYDQYLKQLEQRRREAQERR
MAEQNLNSSINLNQIKALEQQIIKNDLDIYQDSGDDEEEKFAPTGNLDSTDFQQNLSLNI
VENHPNQQDKPKKKDLKDLSSFIKQIAANQGLSVPQSTEIDPEKRKEFEKQYLAFQDITR
NSEEAQKLKKSDPITDLYEFDQSEEEQDEPRELPKVLKNQSSLESQQINKKRKFDEFLKE
TQDPEGHHEYGKFNSTAVEKKISSGMKKRLLTDQIQKQNALDRLKEIHEKTVSDKNQSIK
SFSEATLDFAVRHPIYQFPRDQVLHSRESYAGFYILAVLEMLKYSIKEDYDNQRTEMQLI
PIILEYTKPSQSHQRVLQNANFKNIQNRMKKRKQAFKKKGKGAGGLAAQRQNEEESSSES
EQEENHNSGDESDGETPGSFYVKFKDFLPPLVKKDMMVEDLWILMKRPMVTNQNLADVSE
MLFVKNQWHGHNKQLKIKVSIIGSVDEVRNKVDQYKYAFKSVNLNGFSSLVENLIEFRER
SNPYVDSMLSIKNSKAKFKVLKKCDNLLVEAVRQTTCIQFRLNRDQECVLNEVTKWFLAR
SKTKNNEQAIDDILGGLETNSQQKNPDDHSNVILVHGAFGCGKSYLLVAIIRFICTLLDQ
IGDTQVKILVCALTNIAVDRILLMLKNSEFEDFARVGSLKKINKHLLKYTHHSASNKKQA
DKEAIRELEAMMEEIRSSINPNGKMNQNQYEELMNIQESINHIRSQTIQQRIELLMQKRV
VGATCASTGFEVMKNMQFKIVILDECSQMLEPQSLLPISRFNCRKLIAVGDPLQLPPIIS
FNFKEKKLHQQQILEESKNKVRTQNMIPHLPLFVRLMKEQFYCILLRTQYRCHPMIAQIA
NDLFYENYLENGVKADARKQLIKEFQPVTFISAEKGQESKSEFSYRNYYEAKFIVALLDY
LCCLICQKYSGNKQGGYESSSSSEEEENKSPQNENQQNDAPDFSIGVIVTYKSQEELINQ
MIIDSKNEALKAIQVSTVDAFQGAERDIIIVGCVRTRSLGFIEDCRRLNVAITRARRHLI
VVGKETLLTQNCHWKYIIDKAKNKTDKVYGYKKVNDFIEKGGLFKHMLKDFQ