Identifiers and Description

Gene Model Identifier

Contig621.0.g49

Standard Name

ZGPAT

Aliases

Contig621_0_g49

Description

GC-rich sequence DNA-binding factor-like protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam07842 ) GC-rich sequence DNA-binding factor-like protein
  • ( pfam01585 ) G-patch domain
  • ( pfam12457 ) Tuftelin interacting protein N terminal
  • ( pfam12656 ) DExH-box splicing factor binding site

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004675400.00000000000001000191320216021G-patch domain containing prot
ein
SGDYLR424W0.00006000996057121373SPP382 SGDID:S000004416, Chr X
II from 973395-975521, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig621.0.g49(coding)
ATGTCAGATAAAAAATATGGAGGAATAGGAGGAGCCACTTCAAATACTCGAGGGAGCTCG
ACCTTCTTCAAATCACATAACGGAAATGGTGATGACTCAGACAGCTATGAGTAATTCGAA
ATGGATGATAATGATAATGCACTAGGTTGTGATATTCACTCAGATAAGTAATTCAAAATT
TATGATAAATTAACCAATATTAACAGACCACACAAGAGACAAAAACAAGGCAAGGAAGAT
GCTATATATGGAGTGTTTAATGAGGGAAAGGATTATTTTGAAGATAGGAACTTCAGCAAG
GGGAAGCACTCAGGAAGTGGATTTGATAAGGAATCTTCAACTAAATCTTTCAATGTGGGA
GTTGCTTTTGTAAAATCTAAGTAAACTCCAGTTTAACAACCAAAAGCAATAGCGAAAGTC
ACCGTTCACAATCCAGTTCAGAAAACTCATAAAGACATAAAATATGGATAAAAGCACGTC
TTAAATTAGGGATCTCAATTCAGTAGTAATAACTCAATTTTGTCATCAATAAATAAGAAA
AAAGAAAGAACTGGTCCCAAGAAAAGTGTTAAGTTTAATGAAGAAGTCCAAATTAAGGAG
TTTGAGAAAGATATTATCACTGAGGCTGATAAATAGCAGCACCTTCTAGACGAATTATAA
GCTTGGAGAAGAGAAATCGAACAGTCTGACGAATCAGATGAGGTAATCGAAGAAATTTAA
GATCCCAAACTCGACAAAGATTTCTTTGGCAAGTAATTCGTGAACCAGCCATAAACAGAA
GATAGTGAAGAAAAATACAATTCTGAGGAAGAAAAGGAGTATGAAAAGGAATTGAAATAA
GCTGAAGAGTCTGTGTTCAAAGATTAAGCCATTAAGAGCAAGACAACATATAATGTCATT
TTGCCAAAGAAAAGACCTAGGCAAGAACTGGAATAAGAAGATATTGTCCAGCCTCAGTCG
AGGCAAGGATAGCAAAATGTGGCTTCAGATCTTCCAGTTGGTTTCGGTAGATTAGGTTCA
GCACAACACAACAAACAAGTTTAGCAAAAAAGAGAATAGATTGCCGATCATAAGCAAAAG
AAGTAAGTTGAATAAACACTAGAACAGAAATATGGCAAGGGTGTCAAATTGCTTCAATTC
ATGGGTGGCTATAAAATTGGAGAAGGGCTTGGGAAACATAACCAAGGTATCGTGAATCCC
ATAGAAGAACAGAAGCGAAAGGGTAATGAATGCATAGGCGCATCAGGTCCAGTAAAAGAA
GATAAGAAAGTCAAAGAGCAGCCAAATATTGCAGTCGCAAGCGAAGATTAAAAGAGTTCG
AAAGAGCAGCAAGAAAAGTAGCAGAGAGTTAAGCTTGACTAAGAGGATACTGAATTCTTG
AATTTGCTTAAAATGAGTTAGAAGTAATCTGGGAAAATTCCAAGACAAGTTACTTAAAGA
GGAGGTTTACTTAATTAGTTCAATACTCAAAAATATGCACCTCAAATATCTGAACAAGCT
ACTGTCTTGAAGATTATTGACATGAGAGGAGAAAATCTTTAATCAAATCAAATAAGTGGG
AATCTACTGACAGACTTAAGATAATTATCCTAAAGTTAAACTTCTAAGAGTGAACTTTAC
CACAGCATAAATTAACCTCAACTGTTGTCATAATTCAGTAAACCTAGAGAAAAAGCAAAG
TCTTCTAAATTTGGACTATTTGACTAAGCATTTGAGTTAAAAGAGAAACTCAAGCATTAA
CTATAAACTGTAATAAATTCAAAAACATACAATGAAGGACTACAGGCTTAACTTTAAAAT
GAGAAAGAGAATATAAGTGAATAGTTCTTAAGAGATTAAGAGAAAAAAGCCATACTAATT
GACTTTAAAATGGAATTGGAGAAAATTATCAAAAAGGTTTAAGAATCGCATTCCAGCTAA
TCAAAACATTAAGATGGAAATACTCATTATGACTATTAATCTTTAATTGCAGAATGCTAT
AGTCTTTATGAAAAGTATCCAGAGAACTACAATTAATACAACTCAAGTATATTAATAGCA
AAAACAATTCTATCTCAACCTTACATTAAATCTCAATTCCTAAGATGGGATGTCATATCT
TAGCCACTTTTGATGTTTGACGAAATTTATCAAATTAGAAATCTCTTGACAGTAGGCAAG
TCAGATCATGGAAAATCTTAAAGTTTTTCCACTTCTAAGAATGGCTTTTTATCACACTAT
GATTAAGATAATTTCACAATTTCAAACCCAGACAATGATTATAAGAATGAGGATATTATG
TATTGGATATTTGACAATTACTGGATGCATCCAATGAGAACTTTTATAAGTACTAAATGG
TAAGTTAAAAGCTCAGAGAGCGGAAAGTTGGCAGATTCACTTTAAAGATGGAGTTTGATC
ATGCCAGAAAGATTTTATGATAAAGTTATACAGCTTTATCTGAAGCCAAAGCTTAAAAGA
GAAATAGAAGAATGGATTCCAAAAGACACTTCAGAAGATAACCTTATTTAAAATTGGCTC
TTACCTTGGAAAAATTTACTCTCATAGCATGATTTGTAACCTCTCATAGTTCAACTTAAA
CTCAAACTTTCAACTGCACTCTCTGATTGGAAACCTGACTAACCATTGGCACTAACTTTA
CTCAAGCCACTTTCTTAAGTTGATAATGAATCAAAAGATTTAGCTTAAAATGAGAAACCC
TTCCTTGATCATCAATCTCTGCAAAACATACTCATGAGAAACGTGATTCCAAAGCTAACT
TATTCTTTGAAAGAATACTTCATAATTGATCCTGCGAATTAAGACATATAGCCACTTGTC
TAACTATTTGAATGGGTTGATATAATTGACAAAAGAACCTTGATTTCACTCTTGAGAGAG
CATGTCCTGAATAAATGGATATAAGCCCTGGAGATTTGGCTATAGTAAATAGTTAGTCTA
AAGTAGTAGAGCGAAGAAACCAAAGAAGAGATTTAAGGAGACATTGATGATGTATTGGAA
GAGATAGTTGAGTGGTATAAGGGGTGGAAGAGCTTTATACCTGAGTAGGTTAGGTATGAG
AAAGAGATAGAAGAAGTGTTTAAAATTGCAGTTTACATGATTGATTCGAAGTTGTGA


>Contig621.0.g49(protein)
MSDKKYGGIGGATSNTRGSSTFFKSHNGNGDDSDSYEQFEMDDNDNALGCDIHSDKQFKI
YDKLTNINRPHKRQKQGKEDAIYGVFNEGKDYFEDRNFSKGKHSGSGFDKESSTKSFNVG
VAFVKSKQTPVQQPKAIAKVTVHNPVQKTHKDIKYGQKHVLNQGSQFSSNNSILSSINKK
KERTGPKKSVKFNEEVQIKEFEKDIITEADKQQHLLDELQAWRREIEQSDESDEVIEEIQ
DPKLDKDFFGKQFVNQPQTEDSEEKYNSEEEKEYEKELKQAEESVFKDQAIKSKTTYNVI
LPKKRPRQELEQEDIVQPQSRQGQQNVASDLPVGFGRLGSAQHNKQVQQKREQIADHKQK
KQVEQTLEQKYGKGVKLLQFMGGYKIGEGLGKHNQGIVNPIEEQKRKGNECIGASGPVKE
DKKVKEQPNIAVASEDQKSSKEQQEKQQRVKLDQEDTEFLNLLKMSQKQSGKIPRQVTQR
GGLLNQFNTQKYAPQISEQATVLKIIDMRGENLQSNQISGNLLTDLRQLSQSQTSKSELY
HSINQPQLLSQFSKPREKAKSSKFGLFDQAFELKEKLKHQLQTVINSKTYNEGLQAQLQN
EKENISEQFLRDQEKKAILIDFKMELEKIIKKVQESHSSQSKHQDGNTHYDYQSLIAECY
SLYEKYPENYNQYNSSILIAKTILSQPYIKSQFLRWDVISQPLLMFDEIYQIRNLLTVGK
SDHGKSQSFSTSKNGFLSHYDQDNFTISNPDNDYKNEDIMYWIFDNYWMHPMRTFISTKW
QVKSSESGKLADSLQRWSLIMPERFYDKVIQLYLKPKLKREIEEWIPKDTSEDNLIQNWL
LPWKNLLSQHDLQPLIVQLKLKLSTALSDWKPDQPLALTLLKPLSQVDNESKDLAQNEKP
FLDHQSLQNILMRNVIPKLTYSLKEYFIIDPANQDIQPLVQLFEWVDIIDKRTLISLLRE
HVLNKWIQALEIWLQQIVSLKQQSEETKEEIQGDIDDVLEEIVEWYKGWKSFIPEQVRYE
KEIEEVFKIAVYMIDSKL