Identifiers and Description

Gene Model Identifier

Contig22169.0.g81

Standard Name

ZFRN1

Aliases

Contig22169_0_g81

Description

Zn-finger in Ran binding protein and others

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00641 ) Zn-finger in Ran binding protein and others
  • ( pfam08273 ) Zinc-binding domain of primase-helicase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009716600.00000005999527666938375Zn-finger in Ran binding prote
in and others c...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22169.0.g81(coding)
ATGAGAGACAACAACAAATAGAATGGCTTTCAAGCTGTTTTATTCTTAACACCTCCTAAA
ATTAACCCAGATTCTATACAAAGCACCCCATCACCTATGTACTAAATGGATCAAAATAAA
ATTCTCCTAGGCCAAATGAATAATAAAAATCCCCTTCATTACCAGATGTACTAACCGATT
GACTTTTAGAATCAGCATATGCAAAACACAAATTAGAGGCAACAAGAGTCCTAGTAAAAT
TACAATTCTGGTAAGAAGATGCAAAATTTCCCCACTGCTTAGTATCAGAATTTGTACAAT
TCATCCTATGATAAAGTTCACCTATCTGGTCTCAAATCCCCACCATGCAATACATCAACA
TCTATTCTTCATAGACTTTAGTAATAAAGTAGTTGTAAGTGCTGTGGGCTTCAAAGCTCA
AGTCATAAGAAGAGAGGGTGTGATGATGACTATATGGGAAATGCTCTTCTAATGGGTTAC
GGTGGTATATTTTTAGGCAAAGATTTGTTGAGCATTATTGAATCAAATTCTAGTAACTCA
TCTCCAGCAGCACCAAGAATAGAGCCAAAAATTGAAAGAACTCCCTTCATTAACAATGTC
ACAATGAATAACTCTAACGTTTTGAAAAATATTACTAATCTAGAGCCCAATACTTGTAAA
GCCACTTAATAGCAAGAGAAACTTCAATTTTTGCAGTACAATTTAGATTTTTCAATTACT
CCCAAAGTAGTTTAACTTTCTTACCAACTTCCCCAATTAGGCAAGCATGTTAGCTAAATG
GATCAGTTTCAAGAAAATCAATCAGCTATGAAAGAAAACAATATCAACTTTGTCCCTAGT
TTCAAGAGAGAGAACTCTCTTTAGGATCTGAATTTCTAGGTTACTAGTCACTCAGTTGCT
GGAGACTAGGGAGATGCATAGACTACAGCGAATAATATGAAGTATCGTAAAAAATTATTG
GCAGCCAATCTTCAAAACAATGGTTGCAATACTACCACAAACTAACAAAAAGCTTAGTTA
CTCAAGAATGGTAGCACTACGAACACTTCTTAATCTAGTGCATGCGCTGTAAATGCAAAT
TTCAATTTCCCAGATGGAGGCTGGGTCTGTTCTTAGTGCCAAAATTACAACTTTAGTGGA
AGGACCAAATGTAATCGGTGTCAAAAAGCTAAGTCAAAGTAAGATTTTAATGGTAAGCCA
AAGCATCTTCTTAAAAAGTAACAGTAAGAAGAAGGTGTTCCTTAGTAACTTCAAAATTAG
TAACAAATGCAGCCAATGCAATTATAGTAACATCAAGCATCTCAACCAGATGTGAACTAT
GATTGTCTCTAGAATGAAAATATCACGCCTGAATAGTACAACCAGATGGCCATCTATGAT
AGTTATTAGGCTTTGTATAACGATGCAACTAACAGCTTTTCAGCACTTTCATTGTAAAAT
TAGATATCAAACAAAGAGAATCAATCAGCAAATACTAACAGCGCTCTCATTAAGAAACCT
CTCACTGAGAGAATTGGGGATTGGATATGCCTCAACTGTAAGAACTTGAATTTCTCTTTC
AGAAAGAATTGTAACAGATGTCAATTGACCAGATAGTAATCAGGCAAGATGATTACTCAG
CAAGAGTAACTCGCTATGTAGCAATTCTCTTCCTCTGGTAGTCTCTGTGGAGATCCTGTT
TATTTGAATAATCAACAAATTTTCCAAACTTAAAATGCATATTACCCACAACAGTAAGTC
AACTATATGTATCAACAGTAGTAACAACAACCTGGTCAAGTAAGCTATGAGAGTCCGTAA
GTTTTATCAAACCAGTGCATTAGTAACCAAGGGTCAGGTAATTTTTCTTCAGCAAACTAC
CTCAGTAATATTAGCTCCTTCAACTTCACAACTGCCCAAGATTTGATGAGCTTCTAGAAC
TAACAACTTGCCTAAGAATAATCGATATTCGATTCTCAATAACTCCAGAGAGAGGGAAGT
CTCAACCTCAACAGCCAAAACTTATATAGACAGTGA


>Contig22169.0.g81(protein)
MRDNNKQNGFQAVLFLTPPKINPDSIQSTPSPMYQMDQNKILLGQMNNKNPLHYQMYQPI
DFQNQHMQNTNQRQQESQQNYNSGKKMQNFPTAQYQNLYNSSYDKVHLSGLKSPPCNTST
SILHRLQQQSSCKCCGLQSSSHKKRGCDDDYMGNALLMGYGGIFLGKDLLSIIESNSSNS
SPAAPRIEPKIERTPFINNVTMNNSNVLKNITNLEPNTCKATQQQEKLQFLQYNLDFSIT
PKVVQLSYQLPQLGKHVSQMDQFQENQSAMKENNINFVPSFKRENSLQDLNFQVTSHSVA
GDQGDAQTTANNMKYRKKLLAANLQNNGCNTTTNQQKAQLLKNGSTTNTSQSSACAVNAN
FNFPDGGWVCSQCQNYNFSGRTKCNRCQKAKSKQDFNGKPKHLLKKQQQEEGVPQQLQNQ
QQMQPMQLQQHQASQPDVNYDCLQNENITPEQYNQMAIYDSYQALYNDATNSFSALSLQN
QISNKENQSANTNSALIKKPLTERIGDWICLNCKNLNFSFRKNCNRCQLTRQQSGKMITQ
QEQLAMQQFSSSGSLCGDPVYLNNQQIFQTQNAYYPQQQVNYMYQQQQQQPGQVSYESPQ
VLSNQCISNQGSGNFSSANYLSNISSFNFTTAQDLMSFQNQQLAQEQSIFDSQQLQREGS
LNLNSQNLYRQ