Identifiers and Description

Gene Model Identifier

Contig18.1.g89

Standard Name

ZFRF1b

Aliases

Contig18_1_g89

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010162100.00008003872323201264hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18.1.g89(coding)
ATGGGAAGTAATGACTAGGGAAAAAAGATACTAATGCAAAGAACCATTCTTAAAACCAAT
TATTTCAAGAGAAATTTTGCAGAATTCAATAACTTTCAGCCATTTGAGTTACAATTAGAC
AACTAGGACATAAAAGGATAGAGCATTTTAGTGTAGCCCTCATTTAAAACATTTCTATCA
AATGAAAAGCTGTAGGTTAAGTTTTCATAAGATTAAGAAAAAGCAAAGACTAACTTTATG
CAAAAAGTTATGAACCTTGGGCTTGGTTTTTATGAATTTTTTACCCAAAAAATGTTTGGT
TTCTTAGGAAAAAGTGCTATTTGGTTTCTAAAATGTATTTCAATCTTTGGAGTATATTCC
ACTCTTGATAAATTCGATGAGATAGTATACGATGGCGAAAGAGTAAGAATTTTTGGCATT
TTAGCATTTAATCCCCACTTAAATCAATTTGAAGTGGAAAAGGTTTACTCAGTTTCTACA
TCACTCGATAACTCAGCTTATTACATGGATTAATATTACAAGTTAAGAGTTTTCGAAATG
AAACAAGCTTTTAGAATTTTTTTTATCTTTGCGTTCGCATTATTTGCTACTATTTGTGGA
AGGAAACTTTATTTTAGACTTAAAAGAGTTATGTACGAAACTTACTTAAAGGTATAGGCT
AAATATTACAATTTAAGGTAGAGACAAGAAGTGTAGTAGCTGTTATTGAATGATCCTGCT
GAAGCTAATTTTGATCAATTAAATCCTCAAGATAATAATATTCCTGAGTATTCAGTAGAA
AAACTTGATAAAGTAGTCATAGACGGATTCTTATGTGTAGATTGCAATTAAAACGAGAGA
AATTTAATTTATTTGCCTTGTAAACACCTTCTTAAATGTGATCAATGTTTTATGAAGGAT
GGAAATAGCAAAAGAATTTGTGGATAATGCGAAGGATTTATACAAAAGATTATGAAGATT
TATATAGATTGA


>Contig18.1.g89(protein)
MGSNDQGKKILMQRTILKTNYFKRNFAEFNNFQPFELQLDNQDIKGQSILVQPSFKTFLS
NEKLQVKFSQDQEKAKTNFMQKVMNLGLGFYEFFTQKMFGFLGKSAIWFLKCISIFGVYS
TLDKFDEIVYDGERVRIFGILAFNPHLNQFEVEKVYSVSTSLDNSAYYMDQYYKLRVFEM
KQAFRIFFIFAFALFATICGRKLYFRLKRVMYETYLKVQAKYYNLRQRQEVQQLLLNDPA
EANFDQLNPQDNNIPEYSVEKLDKVVIDGFLCVDCNQNERNLIYLPCKHLLKCDQCFMKD
GNSKRICGQCEGFIQKIMKIYID