Identifiers and Description

Gene Model Identifier

Contig16421.0.g92

Standard Name

ZFRF1a

Aliases

Contig16421_0_g92

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam10080 ) Predicted membrane protein (DUF2318)
  • ( pfam03833 ) DNA polymerase II large subunit DP2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005299500.00000005001214305021125hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16421.0.g92(coding)
ATGGAAGATAATATTGCTTTCGGTTTTGAAATTGCCAGTGCAGTTGTTTGCAGTTTAATA
GGTGGGTTTTAAGTATATAAGACTTCAAAATTAGTCAAGAAGCATAAAAAGCTAAGCAAG
TATCAAGACTTTGTTGAAAAGAATAAAGTTTAATCTGTTGACAGTGCAATTAACACATCA
GTAAAATAATTCGACAATTCCAAGGAAAAACAATTTATCTTAGTAGAGGGTCAAGCTGTA
TCAGGAGCCTTTATTCTCAAGAAAAATGCTAAGAAATGGGATGCAAATTAATCTAAGGAG
CATTTGAAAAAGCTGCACAAGATATATAACAAGCCAGTTTTGCTATCCCGCAATGAATAT
ATAAAGCAGGGATTGTTCAGAGATCATAAGTTTGACTAAGATATCGAAGGTTAAAATTTC
TATCTTCTTGAAAATCATTCAACTAATACCTTATCGAATGAAGAACTGGGGTATATTTAG
ATTTAGCCTTCATCAAAAGTTCACATGTAAGGATTTAATGTGATTCAGAAAAAATCAGAG
GAAAGCTTGAGTTCTAGCGGGTGGAATAGATTCATTAATTCTTTCCTCTCAATGGGATCT
TATCTGATGTACACTAAATTTTCAGAGATCGTGTATGAGGGAGATAAAGTGAAGGTCTTT
GGCACTTTTATCTTCAATCCCTTTGCAAACAGATGGGAGATAGAAAATCCAATAGCTTTC
ATCAACGGCAGCGTAGATGGCTATGTGGATCATTTGTAAAGTGAGAAAATTTGGAATGGT
TTTTCAATTTTTGGCAGAGCTATAGTTTTAGCTGGTTGCGTTGCTGGCCTTGGATGGGCT
TCTTACAGGCTTATGGGAAGATTCAAGAAACATTTGTAAAAACTCGCTAGACAAAGACTT
GAGGAGCAAGATAGAGCGAACAGAATCAGAGATGCTCCACCCTTTGTCAGAGAGGGTGTT
GATAAGATTGAGATTGAATCATTCACTTGTTTGGACTGCAAGAGAGAAGCCAGAAACATC
ATATATCTACCATGTAAACACTGTGAACTTTGCGAGAAATGCTACAAATAAAAGTAAAAC
AAATTTTAATGCGAAAAATGCAATGCTAAAATCGATAAACTTATCAAGATTTATGTTAGT
AGCAATAATGAATGA


>Contig16421.0.g92(protein)
MEDNIAFGFEIASAVVCSLIGGFQVYKTSKLVKKHKKLSKYQDFVEKNKVQSVDSAINTS
VKQFDNSKEKQFILVEGQAVSGAFILKKNAKKWDANQSKEHLKKLHKIYNKPVLLSRNEY
IKQGLFRDHKFDQDIEGQNFYLLENHSTNTLSNEELGYIQIQPSSKVHMQGFNVIQKKSE
ESLSSSGWNRFINSFLSMGSYLMYTKFSEIVYEGDKVKVFGTFIFNPFANRWEIENPIAF
INGSVDGYVDHLQSEKIWNGFSIFGRAIVLAGCVAGLGWASYRLMGRFKKHLQKLARQRL
EEQDRANRIRDAPPFVREGVDKIEIESFTCLDCKREARNIIYLPCKHCELCEKCYKQKQN
KFQCEKCNAKIDKLIKIYVSSNNE