Identifiers and Description

Gene Model Identifier

Contig18156.0.g49

Standard Name

ZFP36g

Aliases

Contig18156_0_g49

Description

Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000520305.002171138422328e-22hypothetical protein
SGDYDR151C0.000000000000005001692698841201CTH1 SGDID:S000002558, Chr IV
from 765155-764178, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18156.0.g49(coding)
ATGTTAAGCAATAATGACTGCGGATTAATGTCAACCTAATTTGATGACGATATGCAAACA
GCCTCCTTCACAATGTCTTCCTTGAATAACTTTATGAGCTTCGATCCTTTCTTAAGTTCT
ACCACTTCCTTTGACCTTCAATAACAGTAATTCTAACAATAAATGCAAACCAAAGTAAAC
AGCTTAGAGTAACTTGAATAATTATAATTATAACATCACAATAGCAGGACTGAAAATGTT
TTCAATATGCATTATACAAGTCCAATGAAGTTACCCACACACAGAGATAGATTCTTTTCT
GATTCTTATCAATCTCTCTCACACAGAGAAGGCTAATACAATTAGATGTACTAGAATTAG
ATTCAGGATTTCCTATACAACAGCCTATGCGATTAAAATCTCAATCAGGATTTTATGGGA
GGCTTACAAATCAACAGAGAAACTCTTTAGAGAAAGTAGAGCTATCAGGTATAACAAGCA
TAATAGACTTTGGATTACTCTCATAATAATTTCTCTATACCTAGTGGTATACAAACTTCA
ACAACTTCAACAAATGTGGACACCTAAAGCAACACTGGCAGCTCCTTTAAAACTAAATAT
AAAACAGAGATTTGTCGTAATTGGGAGCTACATGGTACTTGTAAATTTGGTGATACCTGT
GCTTTCGCACATGGTGACTTCGAGCTACAGAAAAAGTCTCATGTCCCCTCCAAGTATAAA
ACTAAACTATGCAAACAATATCATGAAAACTTATACTGTCCCTATGGATAGAGATGCCAA
TTTGCTCATTCTTAGAGATCATTTTAAGACTGTACAACTTCAGCTAGCAGCAAAAATGAC
AGCATTGAGATCGACAGCTCAAACGGCTTTTCACCCTCTGAAAAGACTTCTAAGTCAGAA
TCTAGCACCAGAAAAGTAAGCTACAAACAAATGCTCGATGAAAATATGAGCTAGATGATG
ACAAGACTCAAGAACTCCTAAAATCCTGAAATTCTGGAATTCAACGTAGTCTACAAACAA
AGACCTAGACTTGACATTTTTTAACAAATGACAAAGCCATAACAACCCAAATGTCATTAA
AATATTCAAAACTTTGAGCTTTAATCCCCAGATAAGAGAGTCAATATGCAAATGAAACAT
AATTAGGATTTCAATGGTTCTAACAGTCATGTGAAGGATATGTGTTGCATGGATTGCTGC
TCTGATAACAAAGACAAGATAAGCCCTATTAAGAGAAGAAAGTAAACTTAGGATTATGAA
AATCTAATGAGTAGTTAGAACATGTACTCAGCTTAAAAAAGTGATAGAAAAATCCACAGA
GTTAAACAATCTCCTCCTCAATAGAAGTCTAGTTTGAACAGTTCAGATAGTGAAATGCAA
CTTGAAAATGAAAATAAAGCTAAGACTCTCAGACAAATGAGAAGGGAGAAGTTCATAAGA
TCAAATAAATTGATAAAGTAAATGCAAAAAACCCACAAATTTTTATTCCTTGCTCATCAA
CAACAAGAATCTGAGTTTTAAGAACCCGAATAATGCAACACAAATCAACTGACTTCTAAC
ATTAGACAAATCTCCCTAATTAACTACCAAGACGACCAAGATTAATGTTGA


>Contig18156.0.g49(protein)
MLSNNDCGLMSTQFDDDMQTASFTMSSLNNFMSFDPFLSSTTSFDLQQQQFQQQMQTKVN
SLEQLEQLQLQHHNSRTENVFNMHYTSPMKLPTHRDRFFSDSYQSLSHREGQYNQMYQNQ
IQDFLYNSLCDQNLNQDFMGGLQINRETLQRKQSYQVQQAQQTLDYSHNNFSIPSGIQTS
TTSTNVDTQSNTGSSFKTKYKTEICRNWELHGTCKFGDTCAFAHGDFELQKKSHVPSKYK
TKLCKQYHENLYCPYGQRCQFAHSQRSFQDCTTSASSKNDSIEIDSSNGFSPSEKTSKSE
SSTRKVSYKQMLDENMSQMMTRLKNSQNPEILEFNVVYKQRPRLDIFQQMTKPQQPKCHQ
NIQNFELQSPDKRVNMQMKHNQDFNGSNSHVKDMCCMDCCSDNKDKISPIKRRKQTQDYE
NLMSSQNMYSAQKSDRKIHRVKQSPPQQKSSLNSSDSEMQLENENKAKTLRQMRREKFIR
SNKLIKQMQKTHKFLFLAHQQQESEFQEPEQCNTNQLTSNIRQISLINYQDDQDQC