Identifiers and Description

Gene Model Identifier

Contig11814.0.g66

Standard Name

ZFP36c

Aliases

Contig11814_0_g66

Description

Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)
  • ( pfam12787 ) EcsC protein family

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005401202.0002795641672355e-21zinc finger protein
SGDYLR136C0.00000000000009996062864481225TIS11 SGDID:S000004126, Chr XI
I from 416658-415801, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11814.0.g66(coding)
ATGGCAGAATCTCAGGATTGGGCCCATCAATACGAGGATAATCAGTATCTCATTGCAGGA
CAGCAAGCTCAAGAAGTGATCGTGCCATCTACACCCTTCCTACATAAATATAAGACTGAA
TTGTGCAAAAACTGGGAGAATTAGGGATCATGCATTTTCGGCGATCAGTGCTCCTTCGCT
CATGGTCTTCAACAACTTCACACCAAGATTGATTTGCCATCTAAGTACAAGACTAGGCTT
TGCAAGAAATATCAGGAGGAACTTTACTGTCCCTATGGAGTGAGATGTTAGTTTATTCAT
TCCGAGAGGAAAACATCCGACGTCTCAAATGAGTCAGAATTCATGAAGAAATAAATTTTC
CAACCTACTCCTCTTGACCCCAAGCTCCCATTGTACAGTGATATACTCTCAGACAATCTT
AAGCTCACAGTTGAGAACTATATTGCTTAGAGAGAAGTATACGGGAACCAAACTTAGATT
CATTACATCAATCAGTATAAGTCCAAGAGACTAGCATGCTTCTAGTAGATGACAACTTCT
CCAACCTAAGGAATTAATGAGATGATTCCTTAGATGTCTTCGACTTAGTACTCTATGAAC
AGAGACAAGAATGAGCTAGTTGCTTAGCTCACTCAAAAGCTCAATAAACTTACCAATGAA
AACGTGGATTCTTAAAACATTGGTAGACTTGAAGTGAACAGCACTTATATGAGAAGCTTC
ATAACCCCAAAAACAAGCACTCAAGAATATGGATAATATTAAGTTAACCAAGGCTTCCTG
AACAAAGGAGACACTATGAACAGAAATCTAAACTATCAAGCATTCTAGCAAAACATGAAC
TAGGACTCACCTATGTTCTCCCAAGGACAACAAGCAAATCACCAGATTATTTATTCTCAA
AGAAAAGTAAGCGGATTTAATCAGGAATACTATGGGCTGGTTTCTCCCTTATACCTCCCT
TAAGTATAGTAGACAGTGACCTTTAAGCCAGTATAAGCTTTCAACTATCATCAACTTTAA
CCATAACAATGA


>Contig11814.0.g66(protein)
MAESQDWAHQYEDNQYLIAGQQAQEVIVPSTPFLHKYKTELCKNWENQGSCIFGDQCSFA
HGLQQLHTKIDLPSKYKTRLCKKYQEELYCPYGVRCQFIHSERKTSDVSNESEFMKKQIF
QPTPLDPKLPLYSDILSDNLKLTVENYIAQREVYGNQTQIHYINQYKSKRLACFQQMTTS
PTQGINEMIPQMSSTQYSMNRDKNELVAQLTQKLNKLTNENVDSQNIGRLEVNSTYMRSF
ITPKTSTQEYGQYQVNQGFLNKGDTMNRNLNYQAFQQNMNQDSPMFSQGQQANHQIIYSQ
RKVSGFNQEYYGLVSPLYLPQVQQTVTFKPVQAFNYHQLQPQQ