Identifiers and Description

Gene Model Identifier

Contig21406.0.g79

Standard Name

ZFDSRBD1

Aliases

Contig21406_0_g79

Description

Domain of unknown function DUF59

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01883 ) Domain of unknown function DUF59
  • ( pfam07288 ) Protein of unknown function (DUF1447)
  • ( pfam12171 ) Zinc-finger double-stranded RNA-binding
  • ( pfam12874 ) Zinc-finger of C2H2 type

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21406.0.g79(coding)
ATGGAACTAAACTACATTGAAAATCAAAAGATTTCCCCTGATTTGAAGAATTATCAAGAT
ACTTGTGACTACATTTGTATTGACATGGAACAACTCGAGAAACATCAAGCTTCTAAATTC
CATAACAGTGAAAAGTTTATTAACAAAACTTCAAAATCCAATTACATGCCTTAACATCAG
AATTAGTGCTCATTTGAATACAACAAATCAGCTACTTCTTTTTGTAATGGAGCAACTAAC
TTTTACCAAGTTTAAAATTGTGGGACTATGTATAAACAATGCCTTGTAAATGTAAACCAC
TATGCAGTAGAATGTCAATGCGATGTTATAAGCGATCAAAAGGAAGTTTAAGTTGACAAT
TCAGATGATACACTAAAGTCACATTCAAGTTATCTTAATCAAAGATAAGATGGTGAGTCC
CAAGATTTAATTTCAAACTATTCAATCATACCTTTGATGGCCCTTTTCCTAAAGCATATT
GTTTACACAACGATAAAGGTATGTAAATATGCATGGGAAACTGTGGATGAAGATGGAAAA
ATTAGCATTACTCTCAGTCTTGATACTTTGACAGAATAAGTGATTGAAGAAATTTCTGAC
GACGCTTACGATGCTATTAAAGAAGGGTTATCTAGTATCAAGGAAAAAATCAAAATACCA
CAAGAAAGAAAAGCAGAAGTTTTAGCCCAGCTAAAGAAAAATGAAGTGAAAAAGGAACAA
AACTAGCAGGCATTTTGCAATATTCCAAACCTCAAATCTAGAGAAACTTCTGTCTATGAT
TCACACTATCAAACGAAAGGACAGCAGAACTATGACCCTGACGAAAATTGTGATCGTAAA
TAGCCTATCGTCCTTAGTCCTATTTCAAGCAATATTGAATTTGTGAGGCAAGTACAAAAG
TAGCAGGCGCATTATGATTAGCTTTCTAGTGAGTATAAGGAGAATTACCAATCAACTCCT
TAACTACCTTTGGCACATCATAATAATCCAGAAATGTTTATTAATAAGAATGTTTCTGAG
AAACCAACATCATTTAAAAAATTATATAGTAAAAATAATTAAAACTCCAACTATCTTCTT
AGATGA


>Contig21406.0.g79(protein)
MELNYIENQKISPDLKNYQDTCDYICIDMEQLEKHQASKFHNSEKFINKTSKSNYMPQHQ
NQCSFEYNKSATSFCNGATNFYQVQNCGTMYKQCLVNVNHYAVECQCDVISDQKEVQVDN
SDDTLKSHSSYLNQRQDGESQDLISNYSIIPLMALFLKHIVYTTIKVCKYAWETVDEDGK
ISITLSLDTLTEQVIEEISDDAYDAIKEGLSSIKEKIKIPQERKAEVLAQLKKNEVKKEQ
NQQAFCNIPNLKSRETSVYDSHYQTKGQQNYDPDENCDRKQPIVLSPISSNIEFVRQVQK
QQAHYDQLSSEYKENYQSTPQLPLAHHNNPEMFINKNVSEKPTSFKKLYSKNNQNSNYLL
R