Identifiers and Description

Gene Model Identifier

Contig13305.0.g95

Standard Name

ZFDD1

Aliases

Contig13305_0_g95

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002392607.001220308967917e-48Zinc finger, C2H2 type family
protein
SGDYOR113W7.998763385146868e-21AZF1 SGDID:S000005639, Chr XV
from 534075-536819, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13305.0.g95(coding)
ATGGAAAAATTCAACAATCACAATTCAGAATCATTTTGTAATTCAGACACAGAGTCAGCC
GATGGAGAGAACGATTTACTCTACGAATTCATTTTTGGCAAGAAAAATAAGCCCAATCAT
GAAAACGAGCTTTCCTATGGCCAGAGTCCCTATGACGCTAGAAAGAGCGGTTCAAAGCAG
CCTAAAAATGCATTCAAAAACGGTAGATTGAATGCTAAGATGAAAAAAACTTTATAAGGT
GTGAAGAGAGACATAGAATCACCCTATCGAAAAGTAGTGGTTACCACAGACTTAAAATCT
AATTCCAAATCAAGAAATGGTGGCGGCCGTCGGTCAGGGCTAAAGGGCACCGGACCTCTA
GTACCCCTCATTGGCTCAAATAACATAGATTGGGACATCGGATCTGCAGCAAAACCTCAC
ATTCCTTCAACTAACCTTGAAACAAGCCTATAGAATGGATCGATATCAAATTTGATACAA
GGGGGCAAAACCCTAAACATGAGAGGCCAGGATGGCTTTTTCGGTTCTCGCAATAGAAAC
AGGCTTTTAAGGAAAAGAGCCAGGTTCATTCAAGGTAAAAGAAATCCAGTACCTAGACCA
TAAAAATCAACTCAGCCTAGAGTCTTCACATGTCACCTAGAGTAATGTGGAAAAGTCTTT
AGTGATCGTGCGTCATTAAAAAAGCACTTGACAGTACATGGTGATAAATTATTTCAATGC
CCAAATGATGGTTGTGGCAAGAAATTCCTTGATAATGCTAAGCTGAAAAGGCATATGCTT
GTTCATACTGGAGAGAAGCCTTATCACTGTGAGTTATGTGGGAAGAAATTTTCCCTAGAT
TTTAACTTGAAAACTCATCTACGGATTCACACAGGAGAAAAGCCTTTCTCTTGTAATTAA
AAAGGTTGTCATAAAAGGTTCAATTAAAAATCTAACCTTCATGCCCACATGCTTACACAT
CATTTTTAAGACCCCAATGGCGAGTCAATCATCATGTAGTCAGCGACCAACTCGATTCAT
GGAAAGTATCTTGCAGCAAAGAGAGTGGGACCACCAGGCACAGGAGGAGCCGACTTGGAT
GATTCTTACATAAGCGAAAAGTAGAAACAGTCCAAGTTGGAAAAGCTTGAGATGGAAATT
AATCGAATAATGGAGAAAAATAATGGCTAACTTTTCATTGTTAAGCAAGAGAAAGCAGGA
GGCAATACCCATCGAGAGGGTGGCAAATCTGACTAGTATAGCCAGGAAGACTGGTCCTGC
ATAGAGATCAGGTAGAGGCCGATCTTTAGAATAAAGTTTCGTCCTAGAAGAGTATGCAAA
CTGCATCAAGAACTAGCAAATTGCGATGCTTAAGAGCAGGAACCATATATTTCTCTCAAT
AAGAGAGAGTTGAAGGAAGCTGATAAAGCTCAAGAGAGATTGTCTAAATCTTCAAGTTAG
ATCGGTGATTAGTCTATTCAAGATCTATCAAGTAGCAAGCAAGAATAGTAGCTGCTTGAT
TAACTAAATATTGAGTAGTTAGATAACTTGAATACTCTAACTGAGGAGGAAATTTCTGAG
AAAATTCCCTATATCAACTCTGATTAAATTGAAGTTTAAGAGAATGTATCGAGCGCCATC
TACCAAGTCCACGAGGAAGTCATATAAGCAGCAGTTGAGGCTCAGATCAGAGTTGAGATG
CAAAGTGTCAATTAATTGTGA


>Contig13305.0.g95(protein)
MEKFNNHNSESFCNSDTESADGENDLLYEFIFGKKNKPNHENELSYGQSPYDARKSGSKQ
PKNAFKNGRLNAKMKKTLQGVKRDIESPYRKVVVTTDLKSNSKSRNGGGRRSGLKGTGPL
VPLIGSNNIDWDIGSAAKPHIPSTNLETSLQNGSISNLIQGGKTLNMRGQDGFFGSRNRN
RLLRKRARFIQGKRNPVPRPQKSTQPRVFTCHLEQCGKVFSDRASLKKHLTVHGDKLFQC
PNDGCGKKFLDNAKLKRHMLVHTGEKPYHCELCGKKFSLDFNLKTHLRIHTGEKPFSCNQ
KGCHKRFNQKSNLHAHMLTHHFQDPNGESIIMQSATNSIHGKYLAAKRVGPPGTGGADLD
DSYISEKQKQSKLEKLEMEINRIMEKNNGQLFIVKQEKAGGNTHREGGKSDQYSQEDWSC
IEIRQRPIFRIKFRPRRVCKLHQELANCDAQEQEPYISLNKRELKEADKAQERLSKSSSQ
IGDQSIQDLSSSKQEQQLLDQLNIEQLDNLNTLTEEEISEKIPYINSDQIEVQENVSSAI
YQVHEEVIQAAVEAQIRVEMQSVNQL