Identifiers and Description

Gene Model Identifier

Contig17470.0.g65

Standard Name

ZFD2a

Aliases

Contig17470_0_g65

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR013C0.0000008998839737394744YPR013C SGDID:S000006217, Chr
XVI from 585585-584632, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17470.0.g65(coding)
ATGTAACCTTACTTCCCTCCAATTTAACCGCCGCAAACTTATGGAACTCCAGCTTTTTTA
AAACCCCAAATAAGTCGTAAGAGATCATTAAATGGCAAGGGCAAATTCGAATGCCCTCAC
TGCTAAAGACGTTGCCAATCTCAGCATGCTATGGATAATCACATCAGAGTGCACACGGGT
GATAAGCCATTCTGTTGCTTGGTGCCGGAATGCGATAAGACATTCAAATAGAAAAGTTAG
CAATATTCACATATGAGAAACTCACATGGCTACAACACAGACTTACTCAAGACAGTCTAA
CCTGGTAGGGCTTCGGATTCAGTAATAGGATAAGTTAACTTAAGTGGAGCAGCTTTAAAT
CATACTAGTAATCAAAATGCTTACTTAAATCCTACAAATTCTTTAATGGGAAATCCAGGT
TTAATGAGCAATAATGGCCCTTATCAAATGGGAGTACCGTAATAAACTTAATCAGCTTTG
TATCCCTAGCTTAATGTTGGATTTGCACATTAGTACCAGAATTAATAGATTGGATTAAAC
TTGAATAATGGATTTAAAGAAGAAGAATAAAAATAATAGTAATTCAACGTTATACTCTAA
GACCCTTTACAAAATCAAGCACTGATCGCATAATCCTTTAACTTGGGTTTAGACCCTTAA
AAAGTACTTAAAGATGAGTAATTCTTAGCTTCTTAATAGAGATTATTCTAGCAACAATAC
AATTAATACAAGCCACCTCCTCAAATATAGAGTCAAGGTAAAAATGATGAAACCAGTAAT
ACTGTTTCCAAAGTGTTCTCAGAAATTAAAAAGCGAACGAAGGGGAAATACTTGAGATAA
ACTCAGGGTGAGGATATTCTTTAATCTGAAGGAGAGCATGAAGACGATGGACTAATTTAC
GATGAGCAGAGCGCCTCAAATAACATATACAATTAGCTACCTATCTTTCAAGATTACCAA
GATAAGAAATATAGTTAAAACCCGAATCAATTACATGATAGTAATCAATCTTAACAAAAT
TTCACTGCAAATGTGCCTTTCATTCACACTTATGACAATTCCTAAAACCAGATGGTTTAG
TTAGATATTTAGCACCATTAACCTACTTTTGATAACAGGAATGGAGGTTTGATTAAAATT
GATTAGCTAATGGACAAAACTCTTTTAAAAACCCAAAATCAACTTGATTTTGACATCGCT
ATTGATAAAGCAATATCAAGGGAGGTACCTGCTAATCAACTTTCAAAAGAAGAAATTCAG
GAAAAACTTTTTTATCCAGACGATTTAATTTCGCAGTATTAAGAACAAATATAGCAGCTA
CAGGAATTATATAATGAAGCTGCATAAGCATAAGGAAATGTAAGTAATTCACAAAATGGA
AGGAAATCAATTGGATATTTAGATTTTAACTACTATAGAAATATTCAATCTGTTAATAAT
ATTCAGTTTCCATATATAATCTGA


>Contig17470.0.g65(protein)
MQPYFPPIQPPQTYGTPAFLKPQISRKRSLNGKGKFECPHCQRRCQSQHAMDNHIRVHTG
DKPFCCLVPECDKTFKQKSQQYSHMRNSHGYNTDLLKTVQPGRASDSVIGQVNLSGAALN
HTSNQNAYLNPTNSLMGNPGLMSNNGPYQMGVPQQTQSALYPQLNVGFAHQYQNQQIGLN
LNNGFKEEEQKQQQFNVILQDPLQNQALIAQSFNLGLDPQKVLKDEQFLASQQRLFQQQY
NQYKPPPQIQSQGKNDETSNTVSKVFSEIKKRTKGKYLRQTQGEDILQSEGEHEDDGLIY
DEQSASNNIYNQLPIFQDYQDKKYSQNPNQLHDSNQSQQNFTANVPFIHTYDNSQNQMVQ
LDIQHHQPTFDNRNGGLIKIDQLMDKTLLKTQNQLDFDIAIDKAISREVPANQLSKEEIQ
EKLFYPDDLISQYQEQIQQLQELYNEAAQAQGNVSNSQNGRKSIGYLDFNYYRNIQSVNN
IQFPYII