Identifiers and Description

Gene Model Identifier

Contig8421.0.g25

Standard Name

ZFD1b

Aliases

Contig8421_0_g25

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL209W0.000000030002053728821195MIG2 SGDID:S000003177, Chr VII
from 95858-97006, Genome...
T. thermophilaTTHERM_002392600.000008000552149328928Zinc finger, C2H2 type family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8421.0.g25(coding)
ATGGATAACCACTTGCGGGTTCATACAGGAGAAAAGCCTTTTATGTGTGCAATTGAAGGA
TGTGGGAAAAGTTTCAAATAGAAAAGCTAGCAATACTCGCATATGCGAGGTGCGCATCAG
TACAATACAGATTTTCTGAAAACTAAAGGTAATAGTGGCTATCTAGGAGGAGGTTCTGAT
GTCAGTAATATGTTTAATCATCAACAACAGAATATCTATTAATAGTAGCAGTTTCAAGTG
AATAATAGTGCTTGTGGCTTAAATTAGCAAATCACTTAGAATCAGTATCCCTAAGAAAAT
AGAATTTAAACTGGTGGAAATTTCTTTAACAATCTTAGAAGAGAGAGCGAATCATACTTT
AATGGCCATGCATAATCAGAAATCCAAATAAAAAACTTGAATGATCATTTAAAACAGCAG
GTTTATCAAATGCCATAAATTCACTAAATGATCGATTATGATCCCGAAGTAGTAAGTTAA
AATAGAATGAGAAGTGCTTGA


>Contig8421.0.g25(protein)
MDNHLRVHTGEKPFMCAIEGCGKSFKQKSQQYSHMRGAHQYNTDFLKTKGNSGYLGGGSD
VSNMFNHQQQNIYQQQQFQVNNSACGLNQQITQNQYPQENRIQTGGNFFNNLRRESESYF
NGHAQSEIQIKNLNDHLKQQVYQMPQIHQMIDYDPEVVSQNRMRSA