Identifiers and Description

Gene Model Identifier

Contig47.0.g79

Standard Name

ZFD1a

Aliases

Contig47_0_g79

Description

Zinc-finger double domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR013C0.00000000019994075865167896YPR013C SGDID:S000006217, Chr
XVI from 585585-584632, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig47.0.g79(coding)
ATGTATACAGGTTATTTCTAAGGCAATCGCCAGCCTTACAAATTTTTATAACGATCTTCA
TCACGGCGCTCAAGAGACAACGCTGGCAAGGGAAAGTTTAGTTGCGATGTATGTGGAAGA
AAATGCTAATCTTAACATGCAATGGATAACCACTTGCGAGTTCATACTGGAGAGAAGCCT
TTTATGTGTGCAATTGAAGGTTGTGGGAAGAGTTTCAAGTAGAAAAGCTAGCAATACTCG
CATATGCGGGGAGCACATCAGTACAATACAGATTTTCTTAAAACTAAAGGTAATAGTGGC
TATCTAGGAGGAGGTTCTGATGTCACTAATATGTTTAATCATCAACAACAGAATATCTAT
TAATAGTAGCAATTTCAAGTGAATAATAGTGCTTGTGGCTTAAATTAGCAAATCACTTAG
AATCAGTATCCCTAAGAAAATAGAATTTAAACTGGTGGAAATTTCTTTAACAATCTTAGA
AGAGAGAGTGAATCATACTTTAATGGACATGCATAATCAGAAATCCAAATAAAAAACTTG
AATGATCATTTAAAACAGCAGGTTTATCAAATGCCATAAATTCACTAAATGATCGATTAT
GATCCCGAAGTAAGGCCACTAAAGAAAGAACATAGAGATGAATTTCAAAAATAATAAGAG
CTGCTCGCTTAGGTAGATTCTAAAGATAACACTCAATCTTAAAATTCAGATGATTTATAA
GCAGTTGATTTGGGTTCAGCCAATAATTTTCCATACTATCAAGAGTACTAAAAACACCTT
TAAAACTAAAGTCTTCAGAAGAACCTAAATGAAATGTTTAATCAGTAGACTATTTCAAAG
AATTAGAACTAATTCTCACCAGATTTTTACAATTAGAAGTTTTAAAACCCATTTACAACA
AACTAAAACTCAAGTTTTTCAGTAATGAGTACAGCTGAGAGTATAACTCCCTTAAAAGGG
AACTCCACTAATAATAAATTAAAACTCAGCAATCTAGCAAATTCCTCACAATTCTATTAA
TTAGTTCTAAAGTAACTCAAACATTAACAAATCCTAGCACCGGATTAAAACATACCTCAG
TAAATCTAAGAGATAAAGCAGCTTGCTCCAAATGATATTAGATATGTGAATTAGTACGAA
TAGAGACTGAAAAATCTAGAGTAGATTTATGATAAAGAAATTGCTAAGTCTGGGTTTTAA
CCCCTGATTTCCTTCACAAATGGAATGAACTAGTTTATGTCAATGCAACCCAGACAGCCC
ACTATTACGATGACTCTTGAACAAAACTGCTGGTAAAACAATCAAAGCTATCCAGAATCA
GCTTTTAATCAGAAAAGTGAGATTGAAGTAATTGAAGTTAATAGTTATAATGGGTAGCAG
CAGTAATAATTACAAAATACTACTAACTTCTAAAATTATTCTATGAATAAGGCTAATCAA
GGGCAGTAATATATATAAAGCTTTTGGCAGAATAATTAACAAAGCAATAGCTGA


>Contig47.0.g79(protein)
MYTGYFQGNRQPYKFLQRSSSRRSRDNAGKGKFSCDVCGRKCQSQHAMDNHLRVHTGEKP
FMCAIEGCGKSFKQKSQQYSHMRGAHQYNTDFLKTKGNSGYLGGGSDVTNMFNHQQQNIY
QQQQFQVNNSACGLNQQITQNQYPQENRIQTGGNFFNNLRRESESYFNGHAQSEIQIKNL
NDHLKQQVYQMPQIHQMIDYDPEVRPLKKEHRDEFQKQQELLAQVDSKDNTQSQNSDDLQ
AVDLGSANNFPYYQEYQKHLQNQSLQKNLNEMFNQQTISKNQNQFSPDFYNQKFQNPFTT
NQNSSFSVMSTAESITPLKGNSTNNKLKLSNLANSSQFYQLVLKQLKHQQILAPDQNIPQ
QIQEIKQLAPNDIRYVNQYEQRLKNLEQIYDKEIAKSGFQPLISFTNGMNQFMSMQPRQP
TITMTLEQNCWQNNQSYPESAFNQKSEIEVIEVNSYNGQQQQQLQNTTNFQNYSMNKANQ
GQQYIQSFWQNNQQSNS