Identifiers and Description

Gene Model Identifier

Contig507.1.g98

Standard Name

ZFAND3d

Aliases

Contig507_1_g98

Description

AN1-like Zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006494705.000468829272308e-18AN1-like Zinc finger family pr
otein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig507.1.g98(coding)
ATGGACTCTAAGCAAGACGACCAGAATATCCCAGTTTTGTGCCACATCTGCAGCACGTTC
TTTGGAAGTAAGGCTACGAACTTCCTTTGCTCTTCGTGCCACAGAGATGAATAGCAGTAC
AATAAACTTGATTCTTAGAAAAATGTAAGCTTGAGTAAACAAGAACTTTCAGAAACCTAA
AACTTAACACAAACATAATAGCAAGAGAGAGTTGAATAAGAAAACTCGAATGAACCCAAA
TCTAATGAAATCGAGGAACCGAAAATGGAAATTTCTCCATCGACTGAGCAATTACCCGTA
GAACCACCAAAACCCCAATACGAGATTCAAGTGAATAAGTCTTTATGCTGGACATGCAAA
AAGAAGGTAGGCTTGCTCGGTTTCTCTTGTAAATGCGACTATGTATTCTGCGGAAAACAT
AGGTATGCGGAAGAGCACAAGTGCCACTTTGACTATCACAGGCAGCACCAGGAGAAGCTT
TGGATCGAAAATCCACTTTGCAAGAATGATAAGTTCAATAGAATCTGA


>Contig507.1.g98(protein)
MDSKQDDQNIPVLCHICSTFFGSKATNFLCSSCHRDEQQYNKLDSQKNVSLSKQELSETQ
NLTQTQQQERVEQENSNEPKSNEIEEPKMEISPSTEQLPVEPPKPQYEIQVNKSLCWTCK
KKVGLLGFSCKCDYVFCGKHRYAEEHKCHFDYHRQHQEKLWIENPLCKNDKFNRI