Identifiers and Description

Gene Model Identifier

Contig14131.0.g106

Standard Name

ZFAND3b

Aliases

Contig14131_0_g106

Description

AN1-like Zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006494703.0007793728221555e-22AN1-like Zinc finger family pr
otein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14131.0.g106(coding)
ATGGAATCAAACTAGTAAAATTAGAGCAACCAAGATAACAACCAACAATCCCCATCTTAA
ATTTAATCTGTAAACACAGATCATGTTGACCCCTCAAAATTCCCTCTCCCAGTTAACCAA
GATCTGCTGCAACAGGTGCAATCTCCAAACCCCCACTAAATCGATGTTGACACTGAAATG
CGTGAGCCAATATTGAGTTAAGTCACTTTAAGCCAGAATCTCGAAGAGTAGAAAGTGGAT
GATGATGGTGTTAAGCAAAATACCAGTGACAGCACCGATCAATAATTGGTAAACTAATCC
CCATCTGATAGCCAACAATTAAAGGTTTCTGACTCAACTTCTGCTGCATCTCAGTAATAA
ATTGATGCTAGTTCTTCTACAGTGTAATCTGACTAGACTTAAATCAAGGAGGTCCCTTCG
ACGGCAAGTGTAGTAGTAGCCCCAGCAGACCCTGATGAGCGCAGACTATGCAGCAAGTGC
AAGACTTTCTATGGAACTTATGTAACAAACTTCATGTGCAGCAAGTGCTTCAAGGAGTCT
GGAGGAGTGTTGTAAAGTGCACAGCAGCAAGCTCAGAAGTTGGCTTAAGAGTAGAAGGAT
AAAGAGCAAAAACTCAAGGAGGAAGAGGAAAAGAAGGAACCACCCAAACCTGTTTAAGAG
GATAAAACTAGATGCTGGGCTTGCAAGAAGAAAGTTGGCTTGACTGGTGTGCAGTGTCGC
TGTGAGTACACCTTTTGCTCGAAGCATCGCTACCCAGAAGAGCACTCATGTGACTTTGAC
TTCAACAACTTCTACAAGAAGAAGTTAGAGACAGAGAACCAAAAGGTTGCTCACAAAAAA
ATTGATAAATTGTATTGA


>Contig14131.0.g106(protein)
MESNQQNQSNQDNNQQSPSQIQSVNTDHVDPSKFPLPVNQDLLQQVQSPNPHQIDVDTEM
REPILSQVTLSQNLEEQKVDDDGVKQNTSDSTDQQLVNQSPSDSQQLKVSDSTSAASQQQ
IDASSSTVQSDQTQIKEVPSTASVVVAPADPDERRLCSKCKTFYGTYVTNFMCSKCFKES
GGVLQSAQQQAQKLAQEQKDKEQKLKEEEEKKEPPKPVQEDKTRCWACKKKVGLTGVQCR
CEYTFCSKHRYPEEHSCDFDFNNFYKKKLETENQKVAHKKIDKLY