Identifiers and Description

Gene Model Identifier

Contig22320.0.g41

Standard Name

ZFAND3a

Aliases

Contig22320_0_g41

Description

AN1-like Zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam01428 ) AN1-like Zinc finger
  • ( pfam00748 ) Calpain inhibitor
  • ( pfam06467 ) MYM-type Zinc finger with FCS sequence motif
  • ( pfam07627 ) Protein of unknown function (DUF1588)
  • ( pfam08209 ) Sgf11 (transcriptional regulation protein)
  • ( pfam09072 ) Translation machinery associated TMA7
  • ( pfam12773 ) Double zinc ribbon

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006494701.0002869940498747e-21AN1-like Zinc finger family pr
otein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22320.0.g41(coding)
ATGGAATCAAAAGATAATAGCGCCACCGTCCTCTGCTCAAACTGCAAGACATTCTTCGGA
AACCACAATACCAACTTTATGTGTTCTAAGTGCTTCAGAGAATCATAGAAATAGGAGCAA
TAGAATCAATCAGCTGAGAAAAAGCAATTTTCTCAACCAACTAATCTCTTTGAAATGAAT
GAACCAGCTGTTAGCACTTTCCAAGTTCAACCAGTAGAAATGAGCCAGTCAAGCTAACAA
CCTGCTTTTGAAGAGGTTAAGCAAATCGAGGTACCAGCAGTAGCTTAAGATGCATAAATG
GCTGACCTATCGCAACAGGAACCATCTCCATAAGAAGAGGTCGTTCAAGTTCAGGTTAAC
AAGAATCTGTGCTGGAACTGCAAACGCAAGGTAGGCCTACTAGGCTTTGTATGTAAATGC
GATTTTGTATTCTGCGGAAAGCATCGCTACGCTGAGGAGCACGACTGTCAGTTCGATTAC
AAGCAACGCCAGCAGGAGAAGCTTGCCAAGGAGAACCCTCTCGTTCAAAGAGGAAAGATC
TCTAAATTCTGA


>Contig22320.0.g41(protein)
MESKDNSATVLCSNCKTFFGNHNTNFMCSKCFRESQKQEQQNQSAEKKQFSQPTNLFEMN
EPAVSTFQVQPVEMSQSSQQPAFEEVKQIEVPAVAQDAQMADLSQQEPSPQEEVVQVQVN
KNLCWNCKRKVGLLGFVCKCDFVFCGKHRYAEEHDCQFDYKQRQQEKLAKENPLVQRGKI
SKF