Identifiers and Description

Gene Model Identifier

Contig13105.0.g80

Standard Name

ZC3H12

Aliases

Contig13105_0_g80

Description

Zc3h12a-like Ribonuclease NYN domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam11977 ) Zc3h12a-like Ribonuclease NYN domain
  • ( pfam10373 ) Est1 DNA/RNA binding domain
  • ( pfam06797 ) Protein of unknown function (DUF1229)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001717901.999981404597394e-31conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13105.0.g80(coding)
ATGCAGGGCTAATAAACGAACACTGGTTCCAATCACAATAGTGGTAAAAAGTCTTTTGAT
CCAAACAACGCTCAACCATTTTATCCTAAAAAGAAACTACACAATCAAGGATACATTTAG
CCAACATTCTAGCACCAATCTGTCAACTTCTAAAATCAACCTTCATATCACAATAATGGG
GGGAAGAGTGTAAGCTAAACTGGAGCTTAAATCATGCCAAACCAATTCAATTAAAAGCCT
TTAATGCAAAATAGAGATGGTATGATCTAACCAAATTTAATGGCTGGATATCAATAGTAT
AATCAATTATTTGCACAATAACAACAAGTTCATGGCACTTCGAGAGGAGGATACAGACCT
TAATCAGGAAATAATTTCTAAAATTAGGAGCGAAGAAGTGATAATTTCAGATAGGGAAAG
AGAGGTGGCTATAACAAGAGAGGTGGGTATTAAATGGTCGAAATCGGGGATCCTTAGGTT
CAGGAAGATCTCATGATCGAATCTAAAAAATAGCAAGAGTCTATCGAAAAAGTCATAATC
AAAGCATAAGACAATTCTATAATGCTCAACATAGAGGTATTTCTAAAAGTGTACAAGAAA
CTTGAAGCGTATCTCGAGTTGTAACTTAAGGTTCAGCATGAACCCTTACAATCAAACTTG
GAGTTCTAAAACCACAGTCGAAGGCTTTCAGGCTGGATTTTGCTATACCTTGAAGAGAGT
TGGAGTTTTTACAATAGAGCTAAGACATTGTTCCCATTTGAAGGAAAGATTTTTAATCAA
TTGGCAGTTATTTCTGCTAAGGAAAATGATTATCTTGCCTCAATATACTATTTCATGTTT
CAAAGTATCTTATATACAAGAATAGGTATAGATGAGCTCGAATAACTAGAGCCAGAAGTT
CACAGGTTGTTAAATGAATATTTCTTACAAATTGATAGAGAATCAAATAAAAGCGATGAC
ATCAATAAAATAATCCACTTAAGCATTGTAATGATTTTTATAGCGCATGCTACTATTGCT
GATTCTATAAAGGACATATAAAAGTAGAAGCTTAAGAAGATGTCTCAAAAATCAACAGAT
GAAGAGGACGATTCATCTTAAGAATCAGAGCTTGAAAAAGCCTTAGGTCATCAACTTCCT
AAATATGCCTTATTACAGCTACAATAGCTTTTGATGCTTATTGTTGACAGAATCTCATAG
CTTCCCTCACCCTGGATCGAAAGTTTAACTCCAATTTTGACATGGCTCACTTTACATAAA
GAGGATGATTTGCTAGTAGCATTCTTTGACATTAATCCTCAAATAGAATAGGATCTATCT
CGTATCCATAAACTCTTAAGTAATTATGTTTACTAAGAAATGAAATTAATTAGAGATGAA
GATGACCAGTTAAAACTCACTTAGATGATTGGCAATACCTTACTTAATGAAGAGACTTTT
TTTATTGGCTTTTTGCCACTTCAATCTTATGTAGATAACAAGAAGTAAATCGGACAAGGA
GTTAAGTGCCCTCCTGAAAAGGAAAATTTGATAAGATCATTGATTCTTAAAGATAATCTT
GAAATGCTGAGATGCACATTTGAGGACAAAAAGTAAAGCAATAACAACAGTCCTATCAAA
GAATCTATGGACACAGAAGAATTGAAAGAATCAGAATAATTCTTCGAGTAGATTGACAAG
CTTGCCATTAACTCACAAAAGCTTGATCAAAAGCCTTTAATAATTGTGGATGCTCAAAAT
GCAGCAATGAGACATGGTGGAGGAAAACTATTCTCAGTTAAAGGTATTTAAATAGTTATC
GAGTTTTGGCACAAAAATGGACATCAGGTGGTCTGCTTCCTCCCTGATTATTTGTTAAAT
TATGATCAAATTAACATCAAGAAAAAGCTTGCGCAAATGAACATAAAAGAAGCCAAAGTA
TCTCAAATTCCTGATAACATATCTTTACTTCACGCTCTTTCTGATAAGGGTTTTATCATT
AAGACACCTCCTTAAGACTATGACGATTCTTACTGTATTAAGTATGCAAAGAAGTTTAAT
GCATTCATAGTAACAAATGATAAGTTTAGAGATTACATTACTAAGTAAGTATCGTCTGAT
TAGGCCAGAGAAAGAAAATGGATTAAGGATCATTCAGTTAGTTATGCATTTAATGGAAAT
GAATTCTTGCCTAATCCTGACTCTAAGATATTTAATCGGTATGAATATGACGATTACAAG
CATTACCCATTAGAGGAAATGTGA


>Contig13105.0.g80(protein)
MQGQQTNTGSNHNSGKKSFDPNNAQPFYPKKKLHNQGYIQPTFQHQSVNFQNQPSYHNNG
GKSVSQTGAQIMPNQFNQKPLMQNRDGMIQPNLMAGYQQYNQLFAQQQQVHGTSRGGYRP
QSGNNFQNQERRSDNFRQGKRGGYNKRGGYQMVEIGDPQVQEDLMIESKKQQESIEKVII
KAQDNSIMLNIEVFLKVYKKLEAYLELQLKVQHEPLQSNLEFQNHSRRLSGWILLYLEES
WSFYNRAKTLFPFEGKIFNQLAVISAKENDYLASIYYFMFQSILYTRIGIDELEQLEPEV
HRLLNEYFLQIDRESNKSDDINKIIHLSIVMIFIAHATIADSIKDIQKQKLKKMSQKSTD
EEDDSSQESELEKALGHQLPKYALLQLQQLLMLIVDRISQLPSPWIESLTPILTWLTLHK
EDDLLVAFFDINPQIEQDLSRIHKLLSNYVYQEMKLIRDEDDQLKLTQMIGNTLLNEETF
FIGFLPLQSYVDNKKQIGQGVKCPPEKENLIRSLILKDNLEMLRCTFEDKKQSNNNSPIK
ESMDTEELKESEQFFEQIDKLAINSQKLDQKPLIIVDAQNAAMRHGGGKLFSVKGIQIVI
EFWHKNGHQVVCFLPDYLLNYDQINIKKKLAQMNIKEAKVSQIPDNISLLHALSDKGFII
KTPPQDYDDSYCIKYAKKFNAFIVTNDKFRDYITKQVSSDQARERKWIKDHSVSYAFNGN
EFLPNPDSKIFNRYEYDDYKHYPLEEM