Identifiers and Description

Gene Model Identifier

Contig10642.0.g77

Standard Name

YTHDF3L

Aliases

Contig10642_0_g77

Description

YT521-B-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR374C0.00020003864201578029YDR374C SGDID:S000002782, Chr
IV from 1224394-1223474, ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10642.0.g77(coding)
ATGAACTTAAATAGTTAGCCATTCGTGCCTGAAGACCAATTGAACAAAATTCACAGATCT
TAAAGTCAAACTAGATATCTTCCAATGTATAAACCAGAAACTTAATTAAGCACACCCAGT
CCAAATTTTCCATAGCAAACTGGTGGCATGAACAAAAGTTAGTAAGAGCAAAGTTTGATT
ACACCTGAAGTCACTAACCAATTAATCCCTCAACCAGAGAGTTTGAATAAGAGTAGCAGT
GAAACCAATTTTAGCGACAAATATTTCTGGCAGCTGATTGATATCAGGAAAAAATTGAAT
GAGCTTTGTCTCATGAGCCTAGATGACCAAGAAAAGGAGAGAAATAAAAAACTTACTGAA
AATTAGCCCATAAATCCTGCACCTTAGACAAGTGTAGAAAAAGCGACGACATAAGCTGTC
TAAGTACCCTCTATAAGTTAGAATTAAGTACCAGACTATAGCAATATTGAGCAGCCAAGT
TTAATAAAGTAGAATTCTGAACCAATTAATAACTAGAATCAGTTTAAAACATATGGATAG
AGTTTGAGTTAAACCAGATATAGTGAATTCTAAAATCAAAATTTGATCACTTTAAATACA
CAGAAAGTTACTTTTGGAACAAAACCAAATGTCTTTACCAATAAACATAGCAATTTCTTT
AGCTTCTCAAATAATTAGCAGCAGCAAAATGCAAAGCCAGAAAATGCTTTCATTAATAAT
TACAACGACAAGTGGAACAACGTTTTATTTTAACCTAACAAGGAAAAACTAAATCAAGAC
AATCCTTCTAATAAGCCATTTTATAACAGTCGTCCTTTTGATTAAAGAGCTACACCCCCT
CAATTCAATTTAGATAATTAAAATATGCGCAATTAACTATAAATGAGCTATCAAAATCAA
AACAGAGAGCAATAATTTGTTTAGGATGAAATTAACTTGAAAAATGATCAAAATTTTATC
TTAAATAATTATCAGAAAAATACTTAAGAGGAATAAAAAATTGAATGCAATCCAGAGCTA
TTAAAGCTTCTCTAAAATCTTAAATATTTTGATTAGTACAAGTAGAGAGTTGACTAATTA
TGCGACTATATCGGAAAATATAATATAAACTAGAAACCAGAAGCTTATGAAACCCAAAAT
ACTTTCTTGACTAACTTTGACACTTTTCTAAATTTTGAAGATTTAAAGAGCAAGGATCAG
GAACAGCATGATGGAAGCACAGGAGGTGATCGTGGAAATGTGGTAAAGAACTCAGAAGAG
CAAACATCAACTGCAAATTCTTCAATGACAAATATGAACTAGTTTAGTCCAAATATACAG
CCAGTGGAAAATCAGAATTTTGAAAATTTCTAAAAAAATAAGAACTTTGTCCCTTCTCAT
AATTATAGAAATGATAAAAACAGAAATTTAGTTAAATATCCTCCAGCTTAAAAATCCTCA
AATCAAATGAGATCTAAGCCAAATCAGAGGCAGCTAGAGAGATACAAAATTGAAAGTATT
TAGGATAAGAATCTTCAAGAATAAATTGAAGATTAAAAGTGCCAGTATAAATCTTAAAAT
CAGCGATATAACTATATGAGTTCTTGTTGTAATTAAGGTGCCTGCTGTTATCAGTAAAAC
ACGAATAACTGTGTCAAGTATCTAAACGAAAATAATTATGTACCCAACCAAATTATTCAT
AGTAAGGATATTAATTTAGAGAGTAGCAGCAAGTGGAAGCCTCCAAGATCAATCTAAAAA
CAACCTGAATTTGTTAGTATGTACCAGAATTCAGATCTTGAAAGTGAATAAACCCCAAAT
CTTATTCCCTAGTGCACCAGCATTGACTATTAGCAATCTAATACCACAGTGGAAGAAAAC
CAAAAGGCTTAAGCATTAAAACCCTATCTGAATCCAGCTTTGAAATTAATTAAGCATGGT
ATTTTCAACTAAGCTTCAGAGAACAGCTTCGAAAATTCAATTCCTTTGTTCTGTAAGCAT
ATAGTAATCCGAACTTGCAATGATGAAAATATTTACAACTCCTTGATTTCAGGAACTTGG
ATACCTCGACCAATGCACGTTCTAATCTTCAAAAGTGTGATTAAGGATGCTATTAACTTG
CAATTATCAAACAACCTCAAGACTGATGTACCAATCTATCTCTTTTTTGTCACTAAAGCC
AAAGGTCTATTCAGAGGTATGGGCCAGATGATGAGTGGGCTAAAAATCGATGTCGATGGA
AACGAATATTTCAATATTAAGTGGATTTTCTTCAAAGATATCGACATCAAAGAATTCGAG
TGCATGAAATACGACGAGGAGACAAATGACTATGTTGGGTCTAATGTCATTACACTAAGT
CATAAAGTGGGCAGAATATTTGTCAAGAAGTTTATAGAGTTCAAATCTAAAAACTCTATA
CTTACAAATGAGAGGCTCAAGCAGTATATTGACAAGAATATTTAATGA


>Contig10642.0.g77(protein)
MNLNSQPFVPEDQLNKIHRSQSQTRYLPMYKPETQLSTPSPNFPQQTGGMNKSQQEQSLI
TPEVTNQLIPQPESLNKSSSETNFSDKYFWQLIDIRKKLNELCLMSLDDQEKERNKKLTE
NQPINPAPQTSVEKATTQAVQVPSISQNQVPDYSNIEQPSLIKQNSEPINNQNQFKTYGQ
SLSQTRYSEFQNQNLITLNTQKVTFGTKPNVFTNKHSNFFSFSNNQQQQNAKPENAFINN
YNDKWNNVLFQPNKEKLNQDNPSNKPFYNSRPFDQRATPPQFNLDNQNMRNQLQMSYQNQ
NREQQFVQDEINLKNDQNFILNNYQKNTQEEQKIECNPELLKLLQNLKYFDQYKQRVDQL
CDYIGKYNINQKPEAYETQNTFLTNFDTFLNFEDLKSKDQEQHDGSTGGDRGNVVKNSEE
QTSTANSSMTNMNQFSPNIQPVENQNFENFQKNKNFVPSHNYRNDKNRNLVKYPPAQKSS
NQMRSKPNQRQLERYKIESIQDKNLQEQIEDQKCQYKSQNQRYNYMSSCCNQGACCYQQN
TNNCVKYLNENNYVPNQIIHSKDINLESSSKWKPPRSIQKQPEFVSMYQNSDLESEQTPN
LIPQCTSIDYQQSNTTVEENQKAQALKPYLNPALKLIKHGIFNQASENSFENSIPLFCKH
IVIRTCNDENIYNSLISGTWIPRPMHVLIFKSVIKDAINLQLSNNLKTDVPIYLFFVTKA
KGLFRGMGQMMSGLKIDVDGNEYFNIKWIFFKDIDIKEFECMKYDEETNDYVGSNVITLS
HKVGRIFVKKFIEFKSKNSILTNERLKQYIDKNIQ