Identifiers and Description

Gene Model Identifier

Contig122.1.g114

Standard Name

YTHDF3

Aliases

Contig122_1_g114

Description

YT521-B-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam04146 ) YT521-B-like domain
  • ( pfam08683 ) Microtubule-binding calmodulin-regulated spectrin-associated

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR374C0.0000000000008001317446409227YDR374C SGDID:S000002782, Chr
IV from 1224394-1223474, ...
T. thermophilaTTHERM_000471000.0000007997233352734267YT521-B-like family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig122.1.g114(coding)
ATGGCAATAGAGTGCCACGATTACAATCAGGGTTTTTGTTTTGAAGGCCCCAATTGTCCC
TACTTGCATATTAAGAAGCCAGAGACATAGAGACCTAAGAAAATTCAAGAATAGTACATT
CAGAAAATGTACAAGTATTTCTAGAATGATGGAATGACAAATAGCTTTTTGCTACTTGAA
TTATTAAACTCAGTTCTTATTGATAAGTTGCAAGACTCACAGTCCATCAATATGTCACTT
GTCAAAAGTTTCAGTCCAGAAAGCCTTGAGATCTCTTAGACGCATCAAGTTTGGGCGACT
TCTCCAGGACCAACAAAAAAGCTAACAAATGCTTTCAAGACTGCTGATCATGTGATTCTG
ATATTTTCAGTTAATGAAAGCAGAAGTTTCTAAGGTTTTGCATTAATGGAGAGTGAACCA
GATATGAACTACAAAAAAGAGTTCTTTCAAAGTGACCCAAATTCAATGATTTAATTTGCA
GGTAATTTTAAAGTGAGATGGATTATACAGGGAGACTATCAATTCAAGGATCTTGAATAC
TTTCCACCCAATCCAATGAACGAAATGTTGCCTATTAAACAATCTAAAAATGGCTAGGAG
CTGCCTTTTAAGTTAGGTAACTATTTGAGTTACCTGCTCTATAACTAGAAAGATCCTTAG
AAGAAAATCATTACCTCTCTAGAAATAATTAATCAGATGCCGCTTATGTTCCAAAGAGGA
CTTAAGCATATTAAGTGCAAAATTAAGACTATGATAAATAAAGCTACCATAGTGCAAATA
GTAATAGTACAAGTGGCGGAGGGAACTTTGGCAATAATTAGTACTATTCACAGAGTATAT
CGAATTAGCAGTAACTATAATGATTTGATGTTTCAAAATGCGTTCTCAATGAAGACATCA
AAGTTAATTAAAGATCAATACATAAATGGTTAAAGCTTTTAGAGTGATAATTGA


>Contig122.1.g114(protein)
MAIECHDYNQGFCFEGPNCPYLHIKKPETQRPKKIQEQYIQKMYKYFQNDGMTNSFLLLE
LLNSVLIDKLQDSQSINMSLVKSFSPESLEISQTHQVWATSPGPTKKLTNAFKTADHVIL
IFSVNESRSFQGFALMESEPDMNYKKEFFQSDPNSMIQFAGNFKVRWIIQGDYQFKDLEY
FPPNPMNEMLPIKQSKNGQELPFKLGNYLSYLLYNQKDPQKKIITSLEIINQMPLMFQRG
LKHIKCKIKTMINKATIVQIVIVQVAEGTLAIISTIHRVYRISSNYNDLMFQNAFSMKTS
KLIKDQYINGQSFQSDN