Identifiers and Description

Gene Model Identifier

Contig17170.0.g39

Standard Name

YSF4

Aliases

Contig17170_0_g39

Description

non-SMC mitotic condensation complex subunit 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam12717 ) non-SMC mitotic condensation complex subunit 1
  • ( pfam12922 ) non-SMC mitotic condensation complex subunit 1, N-term
  • ( pfam13646 ) HEAT repeats
  • ( pfam02985 ) HEAT repeat
  • ( pfam13513 ) HEAT-like repeat
  • ( pfam12765 ) HEAT repeat associated with sister chromatid cohesion

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004860709.996149531968772e-161hypothetical protein
SGDYLR272C2.0001503375893664e-79YCS4 SGDID:S000004262, Chr XII
from 687202-683672, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17170.0.g39(coding)
ATGCTGCAGCTAGAATTTAAGTACCCATTAAGCAAGGAATAATTGTGCGATGAGCCAAGT
GATGTGGGGAGATTTTACGTAAAAGCAAGAAAATTTGTTTCAAATTGGGCTGAAGATTAA
CTCCTGAAAGAATTGGAGATTATTGGTGAAAACTTGTGTGGGTCAGCTGTCAGTAGTGGT
GGAGGAGGACATCATAACAACTTAAAATGGAGTAGAATCATGGACAATGATAACTTTGAT
ACTATCTATTCGATATTGTTCTATTTAGAGACTACTCCTACAAGTGCAAGGAAAGAACTC
ATCGAAAATTTGAATAAAGGTGTTAAGCAGCTCTTAAAAAGCATAGAGAAAAGTCACATA
CTCTTTGATTTAGAGAAAGCTGCTCATAGTAACAATCATCACTATATGAATCGCAGCAGA
TTTGAGTATGGTTCTGTAAATGATCATATATTTAGAAACTCACTTAAGGCTTATGTATAC
TTGATTACTTGGTTTTTACAAGATAATAGCAGACTTAAGGAAACTAAAGATAATCAGCAA
AAATCAAAGAAAAACATTAAAAATCAGCAACAAAAGTAAACCAGAAATATGAACTCATCT
GAAAAGACATAAGCCCTGAATAATGAAATTTAACTTCATACTATTTAATCATTAGGATAT
CTTACTGAAATTTTAGATCTTGATATTAAATACTTATGGGCTGAGTAAAAAGTTGAAGAA
GAATTTGCTAAGGTATTTTTAAAGACTGGCTTTGATATGCTTGAAAACCCTAACAACACC
AAAATTCCAGAAATTAAGGACTCCTTATTTGATATAATGCAAAAATGTATCTCAAAATTT
GCAAATGAAGTCAAGTATATGCAAACATAGAACTCAACTAAGATTATAGATTTACTTTAC
TCTTAAGATAATCTCGCTCCATACATGGCTGAGTTTGTGGGGATAGTATCAAGAGACCAA
GGACCTTAAATGCCATATGTAATCATCAGTGAGCTTACTAAATCAATTTTCAACAACGAC
TCTTCTCATGAAACTATTGGTATAAGAAATGTAGGCATTTTTCTCAAGAAACTTTCAAAG
ATATGTCCCAAAATTATTTATCAAAATTTAAATCTTCTACTAGGGTTTTTCGACTGTGAG
TCATATCTACTAAGGCAAGCTATTATAAAAATCTTGGCAAATATTATTCAGTTAGTTCTC
ACTAATTCAGATTCCATAGATTAAAATACTTAAATGGTTTACACTTAAACTAAGGATAAG
TTCTTAGACTTGCTTTTAAAGAGATTTTATGATAAATCATCTTATTGTAGAGCAAAAGTT
ATTAAAGTTTTCAAAAGACTTACAGAAGCAAACGTGGTCCCAAGATTCAAGTATTTTGAT
TTGTTAAAATGTGTGATTGGAAGGTTGAGAGATCAAACCACAAATGTTCGGAAGAATGCT
TTGAAACTTTTTGGCTAAATAATTGTCATTTATGGAATGATATTCAATGTAGACCTTAAG
AAGGGAGATAAGTTTCTACCACTTGCCGATATCCAAAGGGAAAAGAATCAAATCGTTCAT
GATAGCAAGGAAGTTTAAACTAAATGCGAACAAATTTAAAAAGAAGAATAAAGAATCAAG
AGAAAAGTTATTGAGCAACTAAATATATAGGATGAAGCTTCTGCTTAGATAGCTTTATAG
AGCAATCAAGAATATATGAATATTGCTAAGAAACTTAAAGATAATTTCGAGCTTTTTCAA
TAAACAGAGTACATTTACAAAAGCTTGCAAGAATACGAAGAGTTTATTAAAATAGTTGAT
GATGCTGTATAATTCTTAACTCTTTTGTTATCCAGTAAAACTCAATAAGATACTATTGAA
GCTATTAAGGTTTTTAGGTTGCTTTATCAATTCGGAATAAAAAGTTCGTTAACTGGAATT
AAGAAAATGATGACTCTTATTTTCTCAAAAGATAACAGTGTTCAATAAGCGGTATATGAA
TGCTATAGAGTAATTTATTTTGATCAAAGTTTTCCTACTCAAGAAAAAACTAAGAATTTG
ATAAATTTAGTTTCAAACGCATCTCTTACTGATATTACTTGCATAGAGGAGTTAATGAAG
AAATGTGTGCAAAATGATATCTTTGAAAGGGAAATTTACAACACTCTTTGGAGATACTAC
ACTCACCCAAGCAAAGCTTAAGTTACTAATAAACCCCATACTTTATCAGCTGAATAGTTA
CATAGATTAAGAATTCAGTCAAAGGAAGAGCAAAGAGCGTCAATTTAATTGCTTAGAATG
ATGGGAACTTAAAACATTGAAATTATTTTATCGCAAAAAGATAACTTGTTTGAGTACTCT
CAGAAATTTGCTTTATTTGAAAGACCAGACTTTATTATCTTAAGAGAAGGCTTAATGATT
TATGAGAAGTTGATAATCTTCCAAATGACAAATGACACTTATTAAAAAAAGAAATCGAAA
AGAGAATCAGTTAAGCAGTTAGAAGACAGAGACAAAGAATACTTGTTTAAGCTTTTTGGA
GTTATCATTAAAACATTTGGGACTGATGACTTAGAATGGTTTTGTGCTTCTGAGTAAATT
CTTAATACCCTTTTCAACATTAAAACCAGGAATTCCCCAGACTATGCCAAGTACATCATT
CAAGCTTTGACTACTAAATTATACTCTAAAGATAAGCATCATCAAGAAGCTCCAATTATT
GAAGAGGATTTTAAGAATAGTTAAAATGATGATGAGCCCTAAATTACAGGTGCAAACTAT
TAGTCTTTGAGAAACGATATAACAGATCTTCACTATGCTCAACTTTTCTTTGTAGTGGGA
CATGTATCAATTAAGATGTTAACATATGTAGAATAAATTGAAAGTGAATTAAAGAAATGC
TAAACATACAGCTATGGCGCATAGCAGGAAAAAGGAAGTTCTCTAAACAACTAAGGAGAT
GGGGACGATAATGAAGATGAACTAGACTAAATAGGCGGAGGTAAAGAGGGAGAGATAGAT
CAATATGCATTAATACTTCATAAAATTACTGAAGAGTCTTTGATATAAAATGGAATGCTT
GGGAAATTTTTGCCACCCATAATTAATATAGCCAAGATTACTCTTGAAAAGTATCAAAAT
CCAGATCCAGCCTTAGTTCCATAAATATGTGTTTTGGAAAGATCAGCAATTTTGGCATTA
TGTAAATACATGTGCATTTCTTCATAAATTTGCCAGGATAACATAGATTTGCTTTTCCAA
CTACTTGCCTCAAAGATTGATTACGGAGTGAAATCGAACATTATAATCTCAATAGGAGAC
CTCTTTAATAGATTCCCAAATATCCTAAATGAAAAAACAAAAGACATTTTCAGTTTACTG
CATGATAAGGACACCTATGTTAGAAGACAGGCTCTTATGGTAATTACACACTTGATCTTA
AATGACATGTTAAAACTCAAGGGAGAAATAGTGGATATTTGCATGCTACTCGAAGATCAA
GATGATAGAATCAGAGATTAAGTCAAGCTATTTCTTCATGAATTACACACAAAAGCAAAT
CACATAATTTACAATTTGTTCCCTAAGGCTATCAGTAGACTTTCTAAGGAATTTTAAGAC
ATCAAGAAAGAAGAATTTGAGAATATAGCTAAAAATTTGCTTTCACATATAGACAAGGAT
AAATAAACTGAATCCATAGTGGAGAGATTGTGTTAAAAATTGAAAAACTCAACGAATCAA
ATTGAATGGAGAAATACAGCTTTTTGTCTATCTCAACTCAAATATAACGAGAAGATATTT
GTCAAGCTTTCTGATTAATATGACGATTATAAAGATAGACTTAATTAGAATTCAGAAGTG
AAGGAATACTTCCAATTTATTGTGGTTTAAGCTAAGAAATTTCCAAAACCAGAGATGAGA
AAGCTTGTTGATGATTTCGAGTTTAAGATCAATGCAGATGAAAATACATAGCAATAAATC
AAATCGAACTAGCTTCTATCTGGTTAGAATAAAGGAGGGTAAGGAAAGAACAAAAATAAG
AAAAAGCAATAAAACTAGCAATAGCAGAATCAAGAATAAGATTAATAGGAATTACAGAAG
GAAATCGATTCTTTTCAACCAAAGGGCAATAATTCTAAAAAGAGAGTTAGAGGGACAACT
GATCCTAAACAAGGCCAAATAAATTTCCCGACAACATCTGGATAAAATTAAAAACCAGCT
CAAGGTAAAAATTTAATGCAGCAGTAAGTTTAAACTCCTCAATAAATCTCAGTGAAATCT
GGAAAGAATTCGGCTGTGTAGTCTGGCGTTTAGACCCCATCAAAGTAACAGGCAATTCAA
CCTGGGCATTTAGTTTTCTAATAGCAGATTCAGAGCATGCAAAACCAGCACTAACAGTAA
TAATTACAGATGAAACCTGGGGGTTTAAGTGCACCTCAGTAGCCAAATTCCTTTAGTTTT
AACAATGCAACTATTTAACAGCAAATGTAAAACCCTCAAATGATGTAATAAATGCAGCTC
TAACAATAGTAGCAAATGATGATGTAGCAAGCAGCTTTTCAGTAACAATAACTTCAATAA
TAACAATATTATCAATAACAGCAATAGATGATGACTGCCATGCAATACTAAAACATGACA
CCCTAATAGTTGCTGCACTATTAGTAAATGCAAATGGAGCAGTAGCAGTAACTCGAGCTT
GAGGATGACGAGTATGATGTGGAAGAATGTGATTCTGACAATTGA


>Contig17170.0.g39(protein)
MLQLEFKYPLSKEQLCDEPSDVGRFYVKARKFVSNWAEDQLLKELEIIGENLCGSAVSSG
GGGHHNNLKWSRIMDNDNFDTIYSILFYLETTPTSARKELIENLNKGVKQLLKSIEKSHI
LFDLEKAAHSNNHHYMNRSRFEYGSVNDHIFRNSLKAYVYLITWFLQDNSRLKETKDNQQ
KSKKNIKNQQQKQTRNMNSSEKTQALNNEIQLHTIQSLGYLTEILDLDIKYLWAEQKVEE
EFAKVFLKTGFDMLENPNNTKIPEIKDSLFDIMQKCISKFANEVKYMQTQNSTKIIDLLY
SQDNLAPYMAEFVGIVSRDQGPQMPYVIISELTKSIFNNDSSHETIGIRNVGIFLKKLSK
ICPKIIYQNLNLLLGFFDCESYLLRQAIIKILANIIQLVLTNSDSIDQNTQMVYTQTKDK
FLDLLLKRFYDKSSYCRAKVIKVFKRLTEANVVPRFKYFDLLKCVIGRLRDQTTNVRKNA
LKLFGQIIVIYGMIFNVDLKKGDKFLPLADIQREKNQIVHDSKEVQTKCEQIQKEEQRIK
RKVIEQLNIQDEASAQIALQSNQEYMNIAKKLKDNFELFQQTEYIYKSLQEYEEFIKIVD
DAVQFLTLLLSSKTQQDTIEAIKVFRLLYQFGIKSSLTGIKKMMTLIFSKDNSVQQAVYE
CYRVIYFDQSFPTQEKTKNLINLVSNASLTDITCIEELMKKCVQNDIFEREIYNTLWRYY
THPSKAQVTNKPHTLSAEQLHRLRIQSKEEQRASIQLLRMMGTQNIEIILSQKDNLFEYS
QKFALFERPDFIILREGLMIYEKLIIFQMTNDTYQKKKSKRESVKQLEDRDKEYLFKLFG
VIIKTFGTDDLEWFCASEQILNTLFNIKTRNSPDYAKYIIQALTTKLYSKDKHHQEAPII
EEDFKNSQNDDEPQITGANYQSLRNDITDLHYAQLFFVVGHVSIKMLTYVEQIESELKKC
QTYSYGAQQEKGSSLNNQGDGDDNEDELDQIGGGKEGEIDQYALILHKITEESLIQNGML
GKFLPPIINIAKITLEKYQNPDPALVPQICVLERSAILALCKYMCISSQICQDNIDLLFQ
LLASKIDYGVKSNIIISIGDLFNRFPNILNEKTKDIFSLLHDKDTYVRRQALMVITHLIL
NDMLKLKGEIVDICMLLEDQDDRIRDQVKLFLHELHTKANHIIYNLFPKAISRLSKEFQD
IKKEEFENIAKNLLSHIDKDKQTESIVERLCQKLKNSTNQIEWRNTAFCLSQLKYNEKIF
VKLSDQYDDYKDRLNQNSEVKEYFQFIVVQAKKFPKPEMRKLVDDFEFKINADENTQQQI
KSNQLLSGQNKGGQGKNKNKKKQQNQQQQNQEQDQQELQKEIDSFQPKGNNSKKRVRGTT
DPKQGQINFPTTSGQNQKPAQGKNLMQQQVQTPQQISVKSGKNSAVQSGVQTPSKQQAIQ
PGHLVFQQQIQSMQNQHQQQQLQMKPGGLSAPQQPNSFSFNNATIQQQMQNPQMMQQMQL
QQQQQMMMQQAAFQQQQLQQQQYYQQQQQMMTAMQYQNMTPQQLLHYQQMQMEQQQQLEL
EDDEYDVEECDSDN