Identifiers and Description

Gene Model Identifier

Contig2154.0.g83

Standard Name

YRDCb

Aliases

Contig2154_0_g83

Description

Telomere recombination

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01300 ) Telomere recombination
  • ( pfam03481 ) Putative GTP-binding controlling metal-binding

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004982001.9998521972819316e-89Sua5/YciO/YrdC/YwlC family pro
tein
SGDYGL169W7.003455847728069e-40SUA5 SGDID:S000003137, Chr VII
from 186059-187339, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2154.0.g83(coding)
ATGGAAATAGCAAATAAATAATTCGCAGTCTCAAAAACAGTTATCAAAGAGTATACCTAA
GAAAATATAAGCGAGGCAAGCTCCTTAATACAATAAGGGAAGTTAGTCGCCTTTCCAACA
GAAACTGTGTATGGTTTGGGAGCAAATGCTCTAAACGCTGAAGCATGCCAGTTAATTTTC
ACTTCAAAAGAGAGGCCACTCACTGACCCTTTGATTGTGCATGTTCACTCACTTGAATAG
GCATTATCACTTATTGATTAGTCATGCTAGAAGATATTGCAGATATTCAAGCAAATGGCT
GCTCATTATTGGCCAGGTCCTCTCACTATGGTTGTCAAGGCACACAGGGGATAGGTTCCA
AACATGATCACTGCTCAGACAGGATTTGTCGGACTCCGCATGCCTAATCATCCTATAGCT
TTAGACCTAATAAAATCCTCTGGGCTTCCTATTGCAGCCCCAAGTGCAAATAAATTTGGG
CACGTTTCTCCAACCAAGGCAGAGCATGTATATAAGGATTTTCATGTTGATAGTGAAGTC
TTCATTATTGATGGAGGTTCTTGTTCTTTTGGAATTGAATCGACTGTTCTTAAAATAACC
TATGACGAATCACAAGAAAAACCTTTCATGCTTAAAATCTTAAGAAGAGGAGGTGTCAGT
CAGCAAAACCTAAACTAAACCTTGTAAAGTATGGGCATGGATTCATAATGCTAATTAGAA
TCAGTAAAAAATGATCATTACACAGAAGAGACAGAAAATCTCGAAGCCCCAGGTTAGTTC
CTTAGACATTACTCTCCCGACATAGATTCCTATTTATTTAATGGTCTCAAGGACGACAGC
TAGCTCGAACTCGCGAATTGTGTGCTTCTAGATTTCGGTGGTTTATTCTTATCATTAAAA
GAAAGAGTCAAATATTATTATGACCTCTCAGCTTAGGGTGATTACAATGAAGCAATAAAT
GTGATTTATGATTAACTCAGGTGGGCAGAGACAAAGCAAGATTCTAAATGTGTGTTGATT
ACAAACTTTATAGAACTTTTAGGGGAGAGCGAGAAAGATAAAAGTGGTCATGAACATAAA
GAAGCTCTCTTTGACAGGATATTCAGAGCAACTAGTGGCAAGAAAATCAGTTGA


>Contig2154.0.g83(protein)
MEIANKQFAVSKTVIKEYTQENISEASSLIQQGKLVAFPTETVYGLGANALNAEACQLIF
TSKERPLTDPLIVHVHSLEQALSLIDQSCQKILQIFKQMAAHYWPGPLTMVVKAHRGQVP
NMITAQTGFVGLRMPNHPIALDLIKSSGLPIAAPSANKFGHVSPTKAEHVYKDFHVDSEV
FIIDGGSCSFGIESTVLKITYDESQEKPFMLKILRRGGVSQQNLNQTLQSMGMDSQCQLE
SVKNDHYTEETENLEAPGQFLRHYSPDIDSYLFNGLKDDSQLELANCVLLDFGGLFLSLK
ERVKYYYDLSAQGDYNEAINVIYDQLRWAETKQDSKCVLITNFIELLGESEKDKSGHEHK
EALFDRIFRATSGKKIS