Identifiers and Description

Gene Model Identifier

Contig9679.0.g87

Standard Name

YKU80

Aliases

Contig9679_0_g87

Description

Ku C terminal domain like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

  • ( pfam08785 ) Ku C terminal domain like
  • ( pfam03731 ) Ku70/Ku80 N-terminal alpha/beta domain
  • ( pfam02735 ) Ku70/Ku80 beta-barrel domain
  • ( pfam13519 ) von Willebrand factor type A domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004924601.9999788875029746e-125Ku70/Ku80 beta-barrel domain c
ontaining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9679.0.g87(coding)
ATGAACAAGGAAGCTATTGTAGTCATTTTAGATGTTGGTTCTACTATGAATAAAAACCTT
GGAAACGATGATGAAAATGGAGAGACTAGGTTCTAGACAGCTTTAGAATCCGTGAAAATG
CTCTTTGAACAAAAGTTACTGTATGCTGCTGGCCATGAAATCGGTATAGTATTGATAAAT
ACCAAAGAATCGTCAAATGCCCTGAACGACGCTTACTCTGACTAGTACAAGCATGTCACA
ACATATAGAGATATTTACAAACTGGACTTAGAATCGTTCCGCCAATTAGAACAGATTCAG
TGCGAAAAGGCGCCTATTAAAGATAACGGTGGTGACTTATTAGATGGATTGATTGTGGGT
ATGGACATGTTAGTCAGGCACTGTGGTGAGAGAAAAGTAAAGAAAAGAGTATTCTTGATC
ACAGATGGAGAAAGAGAGACTCAATACGATCAGAAAGAGCTCTAGCAAGTGATTTAAACT
ATTAATGAAAGGGATGCAAGACTCAATGTCATCACTCTGGATTTTTGTGATGACCTAGCA
GAAGATGAGGACGAGGATGAAGAAGATGAGGACTAGTCAAAGAAGAAACAACTCAAAATG
TAACCTAATGAAACAAAAGCCTAATTCAAGAATAAAAAGTTCCTTTCTGAATTGACTGAA
AAAGTTAAAGGAGCCATCTTCCCAGCTAAAGTCGCGATTGAAATTTACCAGCAGTTCAAA
AAGAGAGAAGTGATGGCCAGAACAAAGTACAGAGGTAACTTGGACATCTCAAAAAACTGC
AAATTGAATGTACAAATTTATTCTCGCACTCGTGAAGAAGTTTTCCCCACTCTCAAGAAA
CACTCATTAGTTGCAGATGACTCTAAAAACGCAAAAGAGGGGTTGGTTAAAGTAGAGAGA
CAACTGGCTGAAATCGATGATCCTGATCAGATTGCAGTTCCACCTGATCAGTAAATAAAG
GCATTTAACTATGGAAAATAACTTGTGCCAGTCGCGAAAGAAAATGAGCATGTACTTAAA
TATAAGCCAACTAAGGAAGGAGAAGAAGAGACACCAAGCAACGAATATGTGGACGACAAA
GACATCAAGCTCTAAAGTAGCGATTATGAAAAGGAATTTAAGTTGCTAGGATTCACAGAT
TAGAGCAAAGTTCCTCGTCATCATTTCATAGCAGGCGTTGATGTTGTACTTCCAGTCAGA
GGATCCAAAAATGAGAGAGCTTTTGCTGCTCTAGTATATGCCATGATTGAAACTCATAGA
GTACTCATTGCAAGAATTATCGAGAGAAAGAATGCTGATCCTAAGTTGGTCGTGCTCTAC
CCTCATATCAGTAAAAAGAAGCCACTACTGTATATGGCTTAACTCCCAACAAATGAAGAA
ATACGCGATTATCAATTCCCTTCACTAGTACCAGCATCACGTGATCAAAAGTAAGCTGCC
AAAGAACTTATAAAAGCACTTGACCTCACAAAAGATGTGAATGAGCCAGAAGTAGAAGAG
GAGAAACTCAAGCCAGATTTGACATTCAATCCTGCGCTTTAGTACTTCAGTTAAGTTGTC
GTGCATAGAATCACTCACCCTGAGGAATAAGAGTTACCAGAGCTTAATCAAGCCATAGCA
GAATATGTGAAGCCAGACAAGGAACTGTTCACCCATGCATAAGAAGAAGTAAGCGCCTTT
GAAGAAGCATTCAAACTTGAGCACAATAATGAGGACGAGAATAAGAAACGCAAGAGAATC
TACTGGAGAGACATCATCCAGAGAGAAGAGATCAAAGCAGCTGAAGAACAGAAACAAATG
GAGGAAGAAGCTAGCATAGCACGTATGAAACTAGACTAGAAGGGAGATGGCTTTGAATTC
AAAGATAACGATGGAGCAGTCAAGGAAATCGGTAGTGTAAATCCCATTGAGGACTTCAAG
AAGATGGTCACAGATAGGAAAGTGGACAGAGTCGGCACTGCTATCGATCAAATGAAGGAC
ATGATCACTAAATTGGTCAATAACAGTCTGAACGGGGACTTGTATCACAAAGCCATTGAG
TGTCTGGCATCTCTGAGGGAGGCTTGTATCACTGAGGACGAAGCTCAGAAGTTCAATCTC
TTTATGGAATAGTTGAAGAAACGGTATACATCTGGCTCTAACAAAGGATTCTTCGATATG
ATTGTCCACGAGAAGATTAGTCTCATTACCAAGGACGAGTCCAGCATTAGTTCCACTATA
ACCACTGAGGAAGCTAGACAGTTCCTAATGATGGATGCACCTGTGTAAAATCAAATCCAA
CAGCAAAAGAAGAACCAAGTCGTAGATGACCTATTGGATGAAATTGAATGA


>Contig9679.0.g87(protein)
MNKEAIVVILDVGSTMNKNLGNDDENGETRFQTALESVKMLFEQKLLYAAGHEIGIVLIN
TKESSNALNDAYSDQYKHVTTYRDIYKLDLESFRQLEQIQCEKAPIKDNGGDLLDGLIVG
MDMLVRHCGERKVKKRVFLITDGERETQYDQKELQQVIQTINERDARLNVITLDFCDDLA
EDEDEDEEDEDQSKKKQLKMQPNETKAQFKNKKFLSELTEKVKGAIFPAKVAIEIYQQFK
KREVMARTKYRGNLDISKNCKLNVQIYSRTREEVFPTLKKHSLVADDSKNAKEGLVKVER
QLAEIDDPDQIAVPPDQQIKAFNYGKQLVPVAKENEHVLKYKPTKEGEEETPSNEYVDDK
DIKLQSSDYEKEFKLLGFTDQSKVPRHHFIAGVDVVLPVRGSKNERAFAALVYAMIETHR
VLIARIIERKNADPKLVVLYPHISKKKPLLYMAQLPTNEEIRDYQFPSLVPASRDQKQAA
KELIKALDLTKDVNEPEVEEEKLKPDLTFNPALQYFSQVVVHRITHPEEQELPELNQAIA
EYVKPDKELFTHAQEEVSAFEEAFKLEHNNEDENKKRKRIYWRDIIQREEIKAAEEQKQM
EEEASIARMKLDQKGDGFEFKDNDGAVKEIGSVNPIEDFKKMVTDRKVDRVGTAIDQMKD
MITKLVNNSLNGDLYHKAIECLASLREACITEDEAQKFNLFMEQLKKRYTSGSNKGFFDM
IVHEKISLITKDESSISSTITTEEARQFLMMDAPVQNQIQQQKKNQVVDDLLDEIE