Identifiers and Description

Gene Model Identifier

Contig17155.0.g65

Standard Name

YKU70

Aliases

Contig17155_0_g65

Description

Ku70/Ku80 beta-barrel domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • positive regulation of transcription, DNA-templated (IEA) | GO:0045893
  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

  • ( pfam02735 ) Ku70/Ku80 beta-barrel domain
  • ( pfam03731 ) Ku70/Ku80 N-terminal alpha/beta domain
  • ( pfam03730 ) Ku70/Ku80 C-terminal arm
  • ( pfam05793 ) Transcription initiation factor IIF, alpha subunit (TFIIF-alpha)
  • ( pfam02037 ) SAP domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005617991.9990002532767049e-131ku P70 DNA helicase
SGDYMR284W4.0002685161515803e-16YKU70 SGDID:S000004897, Chr XI
II from 838187-839995, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17155.0.g65(coding)
ATGGATTTCGAGGATTTATTAGAGGAAGGCGGAGAAGGAGAAGATGGAGAATTTCAACAA
AATCCAGACTTGTTTATGTTTGGCATGGACCAGAAAGAGGTAGAAGATATGAAGCAAAAT
AGAGATTCAGTTGTTTTCCTCATTGACTGCCATAGATCCATGCATGAGAAAAACCCGCAC
AATGGAGATGGCGACCCTTCAAATGTGCAGTAGATTCTTGATGCATGCTTGAGTTTCATG
AAAACTAAGATTATTACAAGTGACAACGACAAGATAGGCATCGTACTGTATGGCTGCAAG
CAGACTAACAACCAATTGAACTTCAACAACATCTATGTTTTCTAGAAACTTGACTCGCCA
GATGCATAATCAATAAAACAACTTGAAACTAAAATGCAAGATTTTACTAAGCAGTATGGC
TTTGTCCCAAAAGAGACTCATACCCCACTATTTGAAGCACTTTGGATCTGTCACTAAGAA
TTTAAGGTTGTTGAGAAGCAGAGTTATAACAAGAGAATATTCTTATTCACTAATGAGGAT
AATCCAGGAAACGATAATGATAAGGGTATGGCTTAGCAAAGAGCAAATGATTTATCTTCA
CTCGGTGTGGATATTGAACTGTTTCCCATGCCAAAAGCTCAATAGCAAAGACCAGTATTT
GATGTGAAAAAATTCTATGCAAACATCATTCAATTTGATGAAGAGGAGTAATTCTCAGAA
ATGCTTGGCATCCAGGGCACTCAATCAAGAATCTCTGAATTGATGAAGCGTATTAGAATG
AAAGAGTTTAGAAAAAGAACTCAAGGCAAGTGTTTGTTTAGTTTAACTCCTAAAGCTCAA
ATTGCTCTAAGCTTTTATACAACAGTAATGCCAACTAAAAAACCTACAGCTGCTAAAGTT
AATGCTGTCAATAACAAGCAACTAAGGTCAACTCAAAGATTCATTTGTCAAGACACAGGT
TCAGTTTTATATAAGAATTAAATCGCAAATCACTATCCAGTCGGTGGTGAGAAAGTAAAC
ATCACTCAAGATGATGTCAAGCAAATTAAATTCTTTGATAATGTTGGTATGAAATTAATG
GGCTTTAAACCCAGATCAGCTCTTAAGGTTTTCCACAATATCAAGCACTCTTACTTTATA
TACCCTGATGAGAAGAGAATCACAGGCTCTTCATAAGTTATGGATGCCCTTATTAATGAA
ATGATAAGTGACGATAAAATAGCTATTGTTAGATTTATTCCCAGGGACAACTCAGTTGTT
AGATTTTGTGCTTTAGTGCCATAGAAAGAGAAAGTTGATGATGAAGATGGATTTTAAACA
CCACCAGGTTTCTAGTTGATATTTTTGCCCTATGCTGATGATATAAGAGATATTAATGCA
ATATTTGATGCAGCAGGGTATGGAGAAGAAATCAAAGAAGAGGAAAGTATTTTTGATAAT
TTGACTAATGAAGAGAAACATGCTGCCAAACTTATGGTCAAGAATATGTACATCGACTTC
AATTCAAGAAACTTTGATAATCCATCTCTTCAATAATTCTATGCAGGCCTCTAAGCACTA
GCTTTGAATGAAGATAAGCCTGAATAAGTAGAGGATCATTTGCAACCAGATTACGAAGGT
ATGTAGAGATTCGACCCTGTCATTCAAAAATTCAAGGATATCTTCTTCGATGGTGAGGAT
GAAGATCCTTAGTGCTCAGGCACAGCAAGAGGCCGAGGAAGAGGAGGTGCCAGAGGAGGA
GCTACAAGAGGTGGACGAGGTGCTCGTGGAGGTGCTAAGAGTGGTGCTGGTTCTACTACC
AATAGTTAAGCTACTTAGTAATAACCAGCAGCTGGAAGAGGTAGAGGCAGAGGTGGAGCA
GCACTTAAGAAGGATGTAGTTATGGAAGAATCAGATGAAGACGAGAGAGAACTTCCTTCT
CAATCGCAAGGAAACAATTTAAAACAACAGTCTTAAGCTAGTAAAAAGCGCAAAGAACCA
CCCTCAAAGCTTGCTAATAACAAAAACAAAAAGAGAAAGCGCAATACAAGTGATTCAGAG
TCAGAGGCAGATGAAGTGAGCTCAGAAGAAGAAATGAAAAACTTCATTGTAGATGACGAT
GATAGCGAAGAAGAACAAAAACGTCCAGCTAGAGGAAGTGCAGCAAAATCAAAGCAACCT
GCTAGATCTGCATCAAAGAATCAAGCTTCCTAGGAGTCAAAGGATGAGCAACCTAGTTAG
AGCTAAAAATCAGCCAAGGGATCCGCCAAGAAACCAGCCAAAGCTAAGGAACCAAAAATG
GACTCATTAGAATAGAAGTTTGCAGGGTTAATCAAGGAGGGAGACCTTAAGAAATGCACG
GTGGCTGAGCTTAGAGAATTCTTAACAGTCAAAAATCAACCAAATAAGGGCAACAAAAAC
TTCATGATTGATATTGTTGAGGAATATTTTGAAACTAATTTTGGTATATCATGA


>Contig17155.0.g65(protein)
MDFEDLLEEGGEGEDGEFQQNPDLFMFGMDQKEVEDMKQNRDSVVFLIDCHRSMHEKNPH
NGDGDPSNVQQILDACLSFMKTKIITSDNDKIGIVLYGCKQTNNQLNFNNIYVFQKLDSP
DAQSIKQLETKMQDFTKQYGFVPKETHTPLFEALWICHQEFKVVEKQSYNKRIFLFTNED
NPGNDNDKGMAQQRANDLSSLGVDIELFPMPKAQQQRPVFDVKKFYANIIQFDEEEQFSE
MLGIQGTQSRISELMKRIRMKEFRKRTQGKCLFSLTPKAQIALSFYTTVMPTKKPTAAKV
NAVNNKQLRSTQRFICQDTGSVLYKNQIANHYPVGGEKVNITQDDVKQIKFFDNVGMKLM
GFKPRSALKVFHNIKHSYFIYPDEKRITGSSQVMDALINEMISDDKIAIVRFIPRDNSVV
RFCALVPQKEKVDDEDGFQTPPGFQLIFLPYADDIRDINAIFDAAGYGEEIKEEESIFDN
LTNEEKHAAKLMVKNMYIDFNSRNFDNPSLQQFYAGLQALALNEDKPEQVEDHLQPDYEG
MQRFDPVIQKFKDIFFDGEDEDPQCSGTARGRGRGGARGGATRGGRGARGGAKSGAGSTT
NSQATQQQPAAGRGRGRGGAALKKDVVMEESDEDERELPSQSQGNNLKQQSQASKKRKEP
PSKLANNKNKKRKRNTSDSESEADEVSSEEEMKNFIVDDDDSEEEQKRPARGSAAKSKQP
ARSASKNQASQESKDEQPSQSQKSAKGSAKKPAKAKEPKMDSLEQKFAGLIKEGDLKKCT
VAELREFLTVKNQPNKGNKNFMIDIVEEYFETNFGIS