Identifiers and Description

Gene Model Identifier

Contig2013.0.g16

Standard Name

YJU2b

Aliases

Contig2013_0_g16

Description

Family of unknown function (DUF572)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000135807.003377498796081e-81Cell cycle control protein cwf
16, putative
SGDYKL095W2.0009605191578312e-25YJU2 SGDID:S000001578, Chr XI
from 262277-263113, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2013.0.g16(coding)
ATGTCAGAACGTAAAGTATTGAACAAGTATTACCCACCAGACTTCGATCCCAGCAAACTT
GCTAAAATCAAGAGAGCTAAGGATAAGCAAGACAATGTACGTATGATGCTGCCGATGAGT
GTAAGGTGCAATACCTGTGGAAATTTCCTGTACATAGGCACTAAGTTTAACATGCGCAAG
GAGACTTGCAACGACGAAGACTATCTTGGCATTAAAATATTCAGGTTTTACTTCAAATGC
AGTAGGTGCTATGCTGAAGTCACTATGAAAACTGATCCCAAAAATCATGATTACGTGGCA
GAGCATGGAGCCACTAGAAACTATGAGCCCTGGAGAGATATTTAGCACGCAGAAAATGTG
TTGAAAGCTAAGAGATAGCTTGAGGATGACGACGCCATGAAAAACTTGGAGAATCGTACT
TACGATTCGAAGAGAGAAATGGACGTGCTTGACGCCCTTGAGGAAGTGAAGCAAATGAAC
AAACGTCTAGCCAAAGTCAATCACGAAGAATTACTGTTGAAAACACTGGCTAAATACGAC
AAAGACAAGGATGTGGAGCAGAGAGAAAATGACTATATTAAAGAGAGCTACGAGCAGCAT
AAGGAAAGACTCAAATACAAGAGAATAAATGATTAGAATGGCGGCTACGAGGATGGAGAC
AACTTCGATCGAGATATCGGGACAGTCTATGGCAGGAAGAAAGGAGGAAAGGCTATTAGG
AACATTGATAATCCCTATGAATTTTTGGAATAAATGGCCAATGATGAGACTGGTGAGGGA
TCAGAGGATGATCATGAGGATAGTGACTCTAATGATGAGGGAGATGCTAATGAACCTATC
AAAACAGGAAAAGACCTGTTAAATCAGTTTAAATTGCCTCTTAAGCGTAAATAGCCTGAG
GATAGCAATGGTTTTAATAAACTCGATAAAGATGGATTTAAGCAGCCAATGGCTCTTAGT
AAATCTACTGTTAATGGTGGAAGGATTATGAATAAACTCCCGATTGCAATGAAAAGAGTT
AATAATAATAATGGTATTGGTGTTAATAAACTTCCAGTTAACGCTATAATAAATAATAAA
ACTGAAGCCACAACATATAACAATAAACCTAGTGATAATGGTATTGATTTATTAAGCAGT
CTGGTTGGGTAGTATGATTCATCATCGGATGAAGAAAGTCAATGA


>Contig2013.0.g16(protein)
MSERKVLNKYYPPDFDPSKLAKIKRAKDKQDNVRMMLPMSVRCNTCGNFLYIGTKFNMRK
ETCNDEDYLGIKIFRFYFKCSRCYAEVTMKTDPKNHDYVAEHGATRNYEPWRDIQHAENV
LKAKRQLEDDDAMKNLENRTYDSKREMDVLDALEEVKQMNKRLAKVNHEELLLKTLAKYD
KDKDVEQRENDYIKESYEQHKERLKYKRINDQNGGYEDGDNFDRDIGTVYGRKKGGKAIR
NIDNPYEFLEQMANDETGEGSEDDHEDSDSNDEGDANEPIKTGKDLLNQFKLPLKRKQPE
DSNGFNKLDKDGFKQPMALSKSTVNGGRIMNKLPIAMKRVNNNNGIGVNKLPVNAIINNK
TEATTYNNKPSDNGIDLLSSLVGQYDSSSDEESQ