Identifiers and Description

Gene Model Identifier

Contig5038.0.g104

Standard Name

YEATS4b

Aliases

Contig5038_0_g104

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL317W1.9990871925214856e-61PFS2 SGDID:S000005261, Chr XIV
from 40619-42016, Genome...
T. thermophilaTTHERM_003127709.997019043202629e-21hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5038.0.g104(coding)
ATGGCTAGTCAACAATAGACCTAAGCATCTTTCGATTTCATGGCAACAGATACTAACTAT
ATGCACTATAGAGACTTCGATTTTGATCCAGCTGACAGACCTGCAGTATATCCACATTTT
TCTTATGGAAAAAACATATACCCTTCTTCAATGTGCGAAGATAAAGATTGGGAATGCGCT
TGCCCTAAATTCCTAGCAGAATAGGAAAATAAACAGAGAAATCCCTTATTCGCAGTTTAA
TGGATGCAAGGTGGCAAACGCTTACTTACAGGATCATCGAAGGGAGATATTATTACTTGG
TTTGCTCCAAATTATGAATATGAAAATGCTACATCAGTTCACAGAGACAGAGTTTAATGC
ATGTGCTGGACTAACAATGAAAAGTATTTGATCAGTGGGGATAAAACAGGAAATATAGTA
TACTGTGATAGTAAAATAAGTTATCTCAATAAGTTTTCTGCTCATAACCAGGCATGTATC
AGAGACATCTCTTTCTCTTAAAGCACCTTAAAGTTCTTGTCATGCTCAGATGACAGAACA
GCCAGAGTATTTGATTTTGTTACTACCTAAGAAGAATTCTGCTTTGAAGGGCATGGTTCA
GATGTGAAAACTTGCGACTGGCATCCAACTTAATCCTTAGTGGTAACAGGAAGCAAGGAT
AACTATGTTAAGATATGGGATCCTAAATCAGGAAAGGAAGTTCAAACTCTATAGTCGCAT
AACAATACAATCAACTAGGTGAGATGGAATCCAGTAAATGGAAATTGGCTCCTAACAGGC
TCAAGAGACTCCACTTTAAAAGTTCACGATATAAGAACTATGAGAGAGTTCAATGTCTTT
TAAAAGCACGACAATCAAGTAACAGTAGTAGCATGGCATCCTTTTAAAGAGGAACTTTTT
GTTTCGGCTTCATACAGTGGTCAAATTATATATTGGTAAGCTAACTCTGGGCATTTGCAC
ACAATAAATAATGCTCATAATAATATGATATGGGGTATGGCTTGGCATCCTTAAGGGTAA
ATGCTTGCATCAACAGGTAATGATCATAAAATTAGATTTTGGGGTAGAAACAAGCCAAAT
GAAGATGTACCAAAAACCCCTTAGAATTAATTTTGA


>Contig5038.0.g104(protein)
MASQQQTQASFDFMATDTNYMHYRDFDFDPADRPAVYPHFSYGKNIYPSSMCEDKDWECA
CPKFLAEQENKQRNPLFAVQWMQGGKRLLTGSSKGDIITWFAPNYEYENATSVHRDRVQC
MCWTNNEKYLISGDKTGNIVYCDSKISYLNKFSAHNQACIRDISFSQSTLKFLSCSDDRT
ARVFDFVTTQEEFCFEGHGSDVKTCDWHPTQSLVVTGSKDNYVKIWDPKSGKEVQTLQSH
NNTINQVRWNPVNGNWLLTGSRDSTLKVHDIRTMREFNVFQKHDNQVTVVAWHPFKEELF
VSASYSGQIIYWQANSGHLHTINNAHNNMIWGMAWHPQGQMLASTGNDHKIRFWGRNKPN
EDVPKTPQNQF