Identifiers and Description

Gene Model Identifier

Contig5038.0.g103

Standard Name

YEATS4a

Aliases

Contig5038_0_g103

Description

YEATS family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam03366 ) YEATS family
  • ( pfam06148 ) COG (conserved oligomeric Golgi) complex component, COG2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL107W6.000802209040518e-34YAF9 SGDID:S000005051, Chr XIV
from 420098-420778, Geno...
T. thermophilaTTHERM_005614502.9998215087698487e-30YEATS family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5038.0.g103(coding)
ATGGCATCCCGCTCATCCAACAGAAGACTAAAGAATGTCACAAAGTATGTGCCAATTGCA
GTTGGTTCCATTTCACTATGGCAAGGTAAAAAGGCTCACGAGGAACACACTCATAAGTGG
GCATGTTATGTAAGAGGACTTAACGAGGAAGACATTTCCTACTTTATCAAAAAAGTGCAA
TTTTCATTACATCCCTCTTTCCCAGAGCCAGTTAGAACTATTGAGAAGTTTCCATTTGAG
ATATGCCTGACAGGTTGGGGAGAATTTGATATTGGCATAAAGATCTTTTTCACCGACCCA
GCAGAAAAGCCAGTTGAAATGGGTCATTTGTTAAAACTTTACCCTGGTAACAATCAGCAG
TAATCTACTAAGAAACCTGTAATCAGTGAAAAATACGATGAGATAGTGTTCTTTGAGCCA
ACTGAACATTTCGCATATATCTTAGATAAGGGACCAAAGCAAAATGAACAAGATAGTGCA
AATCAATCAGCGGGAGCCTAAGGACCCTAAGTAGATCAAGTCATGTTAGATGATGCGAGT
TAACCAATTAACCCACTCGAGGAGAATAAAAATGCAAACCCCGAGGAACTCAAATAACAA
TAGACTGCAACTTCATCTTCAACTAAAGAGAAGCAGGACGATAAAAACAAACCACTTGAT
AGGAGACAATTTTTGCAATTTTACGGACCATTCCCATCAGACGATAAAGATATAGACACA
ATTTAAGAGGCATTAGATTTCATAAGATCATAAGTGCAGTAAGCAAGAGAGGAGCTAGTT
GAATACGAGAAGAAAGTCAGTGTAAACAGAAAGTAGGCTAGAGACCTGGATTTAGACTCG
TATTAATAGGCTTGA


>Contig5038.0.g103(protein)
MASRSSNRRLKNVTKYVPIAVGSISLWQGKKAHEEHTHKWACYVRGLNEEDISYFIKKVQ
FSLHPSFPEPVRTIEKFPFEICLTGWGEFDIGIKIFFTDPAEKPVEMGHLLKLYPGNNQQ
QSTKKPVISEKYDEIVFFEPTEHFAYILDKGPKQNEQDSANQSAGAQGPQVDQVMLDDAS
QPINPLEENKNANPEELKQQQTATSSSTKEKQDDKNKPLDRRQFLQFYGPFPSDDKDIDT
IQEALDFIRSQVQQAREELVEYEKKVSVNRKQARDLDLDSYQQA